Identifiers and Description

Gene Model Identifier

Contig1305.1.g89

Standard Name

H3.8

Aliases

Contig1305_1_g89

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001891804.999934616708877e-52histone, identical
SGDYNL031C6.00092892288903e-46HHT2 SGDID:S000004976, Chr XIV
from 576050-575640, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1305.1.g89(coding)
ATGCCCAGACAAAAGATCGCCGGAAAGAAACAGAAGACCAGCTCAAAGCAATCTGTTGCC
ACTGGATCCAAGGCCAGCAAGAACGCCGCCATGAAGAAGAAGACTGCCCCAGCTGAGGGT
GGTGTGAAGTCAGGCCGCAGATACAGACCAGGCACAGTTGCTCTCAGAGAGATCAAGAGA
TACCAGAAGGAAACCAGACTTCTCCTTCTCAAGGCTCCCTTCCAGAGATTCGTCAGAGCT
ATCTGTGATGGAATCGACAACCAACTCAGATTCCAATCACAAGCCCTCCTCGCTGTCCAA
GAAGCTGCTGAGATGTACTTGGTCGGACTTTTCGAAGACTCCAACTTGTGCGCCATTCAT
GCCAACAGAGTGACTGTCATGAAGAAGGACATGGAGCTCGCAAGAAGAATCCGTGGAGAG
AGATTCAGAGATCACAACGACATGCAACCCAAGAATGGGGACGAGGTCTTCTATCAACTT
CCCTACTACGACGAGAAAGAGAAGATGGCCCAACTCAAGAAAGTCATCAACGCCAAGCAT
TGA


>Contig1305.1.g89(protein)
MPRQKIAGKKQKTSSKQSVATGSKASKNAAMKKKTAPAEGGVKSGRRYRPGTVALREIKR
YQKETRLLLLKAPFQRFVRAICDGIDNQLRFQSQALLAVQEAAEMYLVGLFEDSNLCAIH
ANRVTVMKKDMELARRIRGERFRDHNDMQPKNGDEVFYQLPYYDEKEKMAQLKKVINAKH