Identifiers and Description

Gene Model Identifier

Contig22722.0.g27

Standard Name

H3.7

Aliases

Contig22722_0_g27

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam12782 ) Invertebrate innate immunity transcript family
  • ( pfam02969 ) TATA box binding protein associated factor (TAF)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000162009.997441244797434e-45histone H3.3, putative
SGDYNL031C2.00017271388466e-38HHT2 SGDID:S000004976, Chr XIV
from 576050-575640, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22722.0.g27(coding)
ATGCAACCAGGAAAAGGGAAAGGCAAAGGCAAGTTCCTAGGCTCAGGCAAGAAGATTCTC
GGCAGACATCAAGCAAGCTCCACAGAGACTATCCAGACAAACCCGGTTTCGAGCCCCAAC
TACAGAGTGACAAGTTAAGGCCCGCAATCACCTTAACCTCACAATCATCAGCATCGCCCA
CAGAATCTCTCAGCAAGAGTAGCTCGCAAGACTGCTCAGGTAAGCTCGAAACCCAAGGTT
GCCCGCAGATTCAAGCCAGGACAGCTAGCCCTCAGAGAGATAAAGAGATTGCAGAAGGAC
TCGAGTCTACTCATCGCAAGACTACCCTTCCAGAGACTTGTCCGTGAAATCGCCAGGAGC
AGCAACCCAGACATCAGATTTACATCCCAGGGGCTGATTGCGCTCCAGGAAGCAGCCGAA
TGCTTTTTGGTAGGCCTATTCGAGGATGCGTACCAGTGTGCGGTTCACGCTAAGAGAGTG
ACTCTCCTATCAAAGGACATCTAGCTAGCCAGAAGGATCAGAGGAGAGCGCTTTGGCAAG
TCTAATTGA


>Contig22722.0.g27(protein)
MQPGKGKGKGKFLGSGKKILGRHQASSTETIQTNPVSSPNYRVTSQGPQSPQPHNHQHRP
QNLSARVARKTAQVSSKPKVARRFKPGQLALREIKRLQKDSSLLIARLPFQRLVREIARS
SNPDIRFTSQGLIALQEAAECFLVGLFEDAYQCAVHAKRVTLLSKDIQLARRIRGERFGK
SN