Identifiers and Description

Gene Model Identifier

Contig938.1.g137

Standard Name

H3.3

Aliases

Contig938_1_g137

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam02291 ) Transcription initiation factor IID, 31kD subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001891806.000287828677204e-80histone, identical
SGDYNL031C1.0004671766404936e-76HHT2 SGDID:S000004976, Chr XIV
from 576050-575640, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig938.1.g137(coding)
ATGGCAAGAACTAAGCAAACAGCAAGAAAGAACACTGGAGCTAAAGCCCCAAGAAAGCAA
CTCGCTAATAAGGCCGCAAGAAAGACAGCCAGCGTCCATGCTACAAGTGGCGTCAAGAAA
CCCCACAGATTCAGACCAGGTACCGTTGCTCTGAGAGAAATCAGAAGATTCTAAAAATCC
ACTGAACTTTTGATCCGTAAGCTACCCTTCCAGAGATTGGTCAGAGAAATCGCTCAGGAG
TACAAGAGCGACTTGAGATTCTAAAGCCAGGCTGTCTTAGCTTTACAAGAGGCAGCTGAG
GCTTACTTGGTCGGGCTCTTCGAAGATACCAACTTGTGTGCCATCCATGCAAAGAGAGTG
ACAATCATGCCAAAGGACATCCAACTCGCAAGAAGAATCAGGGGTGAGAGAACTTGA


>Contig938.1.g137(protein)
MARTKQTARKNTGAKAPRKQLANKAARKTASVHATSGVKKPHRFRPGTVALREIRRFQKS
TELLIRKLPFQRLVREIAQEYKSDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRV
TIMPKDIQLARRIRGERT