Identifiers and Description

Gene Model Identifier

Contig14821.0.g11

Standard Name

H2B.4

Aliases

Contig14821_0_g11

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR224C6.998542127613979e-20HTB1 SGDID:S000002632, Chr IV
from 914712-914317, Genom...
T. thermophilaTTHERM_002831801.000116773704384e-19Core histone H2A/H2B/H3/H4 fam
ily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14821.0.g11(coding)
ATGAAGAAAGCTTCAGCTAGATCCAAGAGCCCAGCTTCCAAGCAAATTGCAGCAGGCATG
GACCAAGTCAACCAGAGTTTGAGCAGTGTGAACTTGTCAGGAACATCCAACAAGTCAGGT
ACACCCAAGAGACCAGCAGAGCAGCAGCAACCTGTCATGATGAACACCACTAGTCCTAAG
AGAGGAGCTGAGACCATGCAGGCAAGCTCAACAGGCAAGGGGAAAGCAGTTGCCCAGAAG
AGTTCAAACTTGCCAAATGTTGTTAAGGTACATTCATCTGTCACAGCCGCTAATTAAGCA
CAAGGCAAAGCTACTCTCAAAGTCAACAACTAGGAAGCTACTATCTCAAGAACATCAGAT
GAGAAGAGAGGAAGAGGAAGACCTAGAGCATAAGATGATCCAAGCAAGACTGGCTAAGAC
AGGACATCAAACCCAGCAACTGTACAGCTTGGTCAGAAAAAGAAGAAAGCTCTTCTACGT
CTCCGCGATGACAACTCTTTCTAGACCTACATCTTCCGAGTTGTAAAGGACGTGAAGCCA
GAGTTGAGCATCACCAAGCAAGCAATGAAGCAGTTGAACCAGATCATGATCCACTTGTTT
GAAATGCTGATGGAAGAGGCCCGCAACTTGCTCATCTACAACAAGAAGTCCACACTTTCC
AGCAAAGAGATTCAGTCTGCCGTCAAGATGATGTACCCAGGAGAGTTGCAGAAACTTGGA
CTGCAGTATGGCACAGAGAGTCTCGCTAAGTTCACTCAGGCACAGAACAACTGA


>Contig14821.0.g11(protein)
MKKASARSKSPASKQIAAGMDQVNQSLSSVNLSGTSNKSGTPKRPAEQQQPVMMNTTSPK
RGAETMQASSTGKGKAVAQKSSNLPNVVKVHSSVTAANQAQGKATLKVNNQEATISRTSD
EKRGRGRPRAQDDPSKTGQDRTSNPATVQLGQKKKKALLRLRDDNSFQTYIFRVVKDVKP
ELSITKQAMKQLNQIMIHLFEMLMEEARNLLIYNKKSTLSSKEIQSAVKMMYPGELQKLG
LQYGTESLAKFTQAQNN