Identifiers and Description

Gene Model Identifier

Contig9113.0.g47

Standard Name

H2B.3

Aliases

Contig9113_0_g47

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam03847 ) Transcription initiation factor TFIID subunit A
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone
  • ( pfam03428 ) Replication protein C N-terminal domain
  • ( pfam04997 ) RNA polymerase Rpb1, domain 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR224C2.000214949834694e-50HTB1 SGDID:S000002632, Chr IV
from 914712-914317, Genom...
T. thermophilaTTHERM_002759107.002411919958887e-50Core histone H2A/H2B/H3/H4 fam
ily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9113.0.g47(coding)
ATGGTCGGAAAAGCAAAGGGAGAATCCTCATCAGCTTCAAAGAATATCGAGAAGAAGAAG
ACTGCTCCATCCTCTGCTAAGGGTGACGATAGTGAGACAGTGAGAAAGGTAGGTGGTCCT
GGCAGAAAACAACCTAAGAGAGCAGAAACCTACTCAGTCTACATCTACAGAGTGCTCAAG
CAAGTGCATCCAGAGACTGGTATCTCCAAAAGATCTATGAGTATCATGAACTCCTTCATC
AACGACATTTTCGAGAAGATTTCACTTGAAGCCTCAAAGTTGGTTAGATACAACAAGAAG
CAGACTCTCTCATCCAGAGAGGTTCAGACTGCAGTCAGACTCTTGTTGCCAGGAGAACTC
GCCAAGCATGCCGTCTCAGAAGGTACAAAGGCAGTCACTAAATATACCAGTGTGTGA


>Contig9113.0.g47(protein)
MVGKAKGESSSASKNIEKKKTAPSSAKGDDSETVRKVGGPGRKQPKRAETYSVYIYRVLK
QVHPETGISKRSMSIMNSFINDIFEKISLEASKLVRYNKKQTLSSREVQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSV