Identifiers and Description

Gene Model Identifier

Contig14080.0.1.g76

Standard Name

H2A.6

Aliases

Contig14080_0_1_g76

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00125 ) Core histone H2A/H2B/H3/H4
  • ( pfam00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003165001.0003081162615753e-33Core histone H2A/H2B/H3/H4 fam
ily protein
SGDYDR225W1.9991517704232713e-32HTA1 SGDID:S000002633, Chr IV
from 915530-915928, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14080.0.1.g76(coding)
ATGCAGCCAGCCAAGGCCAAGCGTTCTGGTCAGGACAAAGCAGGACTCCATTTCTCCATC
TCCAGAACAGCCAAGTACATGAAGCAAGGTAGATACGCTGAACGTATCGGAGGAGGTGCA
CCAGTCTACCTCGCAGCATGCATGTAGTATGTTTGCGCTGAGATCATTGAGCTTGCAGGC
AGTCAAGTGGAGCAGGAGAAGAAGCAGAGGATTGCACCTAGACATGTGATGTTGGCAATC
ATGAAGGACCCTGAGCTATGCAAGATGCTAGGTAACGCAGATTTCGCAAGATGTGGAGTT
GTGCCAAACATCACAGGAGTCGACAAGAGAGGCAAGAAGGGAAAGAAGTGCTAGGCAGTA
GAGGAGGAAGAGAAAGACGAGGATGAGGAGATGGAAGACGCCCAATGA


>Contig14080.0.1.g76(protein)
MQPAKAKRSGQDKAGLHFSISRTAKYMKQGRYAERIGGGAPVYLAACMQYVCAEIIELAG
SQVEQEKKQRIAPRHVMLAIMKDPELCKMLGNADFARCGVVPNITGVDKRGKKGKKCQAV
EEEEKDEDEEMEDAQ