Identifiers and Description

Gene Model Identifier

Contig17088.0.g8

Standard Name

H2A.4

Aliases

Contig17088_0_g8

Description

Core histone H2A/H2B/H3/H4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001436607.00293386439118e-45Core histone H2A/H2B/H3/H4 fam
ily protein
SGDYOL012C3.00039543526891e-44HTZ1 SGDID:S000005372, Chr XV
from 303983-303579, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17088.0.g8(coding)
ATGAATCTTTTAAAGAAATCTTACGGATTGAAGGGTAAAGGGAAAGGTAAAGGAGGTAAG
AGTGGAAACAAATTTGGGAAGAAAGGACCGGTAACTAAATCTTTAAAAGCTGGTCTACAC
TTTCCAGTTGGCAGGTTGCATCGTCAGCTGAAACTTAGAACACAGGCTTCATCAAGAGTG
GGAGCTACTGCCGCAGTTTATTCAGCTGCTGTCTTGGAATACCTGACTGCAGAAGTGTTA
GAATTAGCAGGAAATGCTTCTAATGATTTGAAAAATAAAAGAATCACACCCAGACATCTC
ACACTTGCCATAAGAGGCGATGAGGAGCTGGATACACTAATTAAAGCGACTATTGCTGGT
GGTGGAGTCATCCCACACATTCACAAGAGACTAATTACCAATACAAAGAAAACTAAGAAA
TAGTTACAATCTAAGTGA


>Contig17088.0.g8(protein)
MNLLKKSYGLKGKGKGKGGKSGNKFGKKGPVTKSLKAGLHFPVGRLHRQLKLRTQASSRV
GATAAVYSAAVLEYLTAEVLELAGNASNDLKNKRITPRHLTLAIRGDEELDTLIKATIAG
GGVIPHIHKRLITNTKKTKKQLQSK