Identifiers and Description

Gene Model Identifier

Contig10099.0.1.g76

Standard Name

H1.1

Aliases

Contig10099_0_1_g76

Description

Domain of unknown function (DUF4407)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10099.0.1.g76(coding)
ATGTCAGGAAAGAAACATACATTCTTCGAGATGATTGAGGATGCCGTCCTCGTCCTTGCA
GATAGAAAAGGTTCAACTCGCCAAGGAATCTGGAAGTGTATCAGCACCAAGCACCCTGAG
GTTGACTACAAGCAATTCTTGATCAGATTCAAAAAGATCAAAGAAGATCCAAACCTTGCA
GTCAATGGCATGAGAGTGAGACTTGACAGAAAGTACAAAGATAAACTTATGAAGAAGTTG
AAGAATGGTGAGACTCCCATGAAATCCAAAAAAACTAAAGCCACCACCAAGAAAAACTCC
AAGAGAAAGTCCGTCAGAACAAACAAAGCTGCTTCCAACAAAGCAAACAAGAAAGGCAGA
TCTACCACTAAGAAAGGTAAATCAACCTAGAGAAAGTCAGGAAAGATGGGTGCTAAGGGT
AAATCAGCTGGAAAGAGAGGAAGTGGAAAGATGGCTACTGGCAAGAAAACTCAAGGATCT
AAGAAGACTCAGGTTCAAAAGCAAACAAAGAAAGAGATGAACCAGAAGAAAGCTGAGATG
AACAAGTCAAAGAACTCTAGATCAACTGTTGGAAAGAAGCAAGATACAAAGGCTAAGAAT
ACTATGGCCAAGAAATCAACAGCGGGTGGGGCCAAGAACAAGGGAAAGCAAGGTGCAAGA
TGA


>Contig10099.0.1.g76(protein)
MSGKKHTFFEMIEDAVLVLADRKGSTRQGIWKCISTKHPEVDYKQFLIRFKKIKEDPNLA
VNGMRVRLDRKYKDKLMKKLKNGETPMKSKKTKATTKKNSKRKSVRTNKAASNKANKKGR
STTKKGKSTQRKSGKMGAKGKSAGKRGSGKMATGKKTQGSKKTQVQKQTKKEMNQKKAEM
NKSKNSRSTVGKKQDTKAKNTMAKKSTAGGAKNKGKQGAR