Identifiers and Description

Gene Model Identifier

Contig2623.0.g78

Standard Name

GUF1

Aliases

Contig2623_0_g78

Description

GTP-binding protein LepA C-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam06421 ) GTP-binding protein LepA C-terminus
  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam00679 ) Elongation factor G C-terminus
  • ( pfam00071 ) Ras family
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam09439 ) Signal recognition particle receptor beta subunit
  • ( pfam00025 ) ADP-ribosylation factor family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004941309.997093137033517e-262GTP-binding protein LepA conta
ining protein
SGDYLR289W1.0000832086161474e-142GUF1 SGDID:S000004280, Chr XII
from 715089-717026, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2623.0.g78(coding)
ATGTTTGTACCGAATCTGCCAAGTTCTAAATAATTCTCAAATATGAACGAGACTAATGGC
GAATTCAAGATCTTGATTAACGATACAAAGACAGGAGGTTAATAGAGAATTTTGATCACA
AATATATAAGGAACTATCAATAAGTTAACCAAAGAAGATCATCATTAAGTTCTTGATACT
TTGAAGGTTGAGAGGGATCGTGGAATCACAGTAATAGCTTAAACAGCGACTATGATCTAT
AAGTATTAGGGAGTGGATTATTTGATGAATTTGATTGATACACCTGGTCATGTAGATTTC
ACTTATCAAGTCAGTCGAAGTATCAGAGCATGTGAAGGAGCTTTGTTGGTAGTTGATGCA
ACCAAGGGCATTTAAGCCTAAACTATCTCTAATTTTTACCAAGCTTTCGATGCAGGCCTA
ACTATAATTCCAATAATTAATAAAATTGACTTGCCAGCTGCAGATGTCGATGCAACAAGG
CAACAACTGATCGAGTAGTTTGACTTCAAAGAAGAAGAGATTTTATATATCTCTGCTAAA
GAAGGTAGAAATGTGATGGAAGTCTTAAACTAAACAATTGAAAGAGTTTCATCCCCGTTC
CCTGAAAAGTCTCGTGATGAACTTGCTAAGCTTCCACTAAAAGCTTTCTTGTTTGATGCA
AGATTCGTGTAAAGTAGAGGTGTCAGTTGCCTGATAAAGATTATGCAGGGAACACTTGAC
ATGCAGAAATTGCGTAACCTGATGTCGTATCACAGATCAAAGCGTTATGACTTATTTGAA
CTTGGAATTGTACAACCAAATATGGTTCCTATAGGTATTTTAAATCCTGGTCAAGTGGGA
TATTTCCTATCAAATATGAAATCAGTTTAAGATGCACATATTGGTGACACATTCTATGAT
GAGAAGTACCAAAAAGATAGTATTGAGCCATTTCCTGGTTATGCTACTCCTTAACCTATG
GTTTTCGCTGGCATATACCCAGAAGACCCTGATGACTATGAAGATTTAGAGAAGTCATTA
TAGAAGCTATGTCTTACTGATGGAAGTGTTTCTTTTAATTATGAATCAAGTGCAGCGCTA
GGAAGTGGTTTTAGGTGTGGATTCTTAGGAATGTTGCATTTAGATGTATTTAGATAAAGA
CTAGATGATGAACATGATATGGTATCTATCATTACTGCACCTACAGTCTCTTATAGAGTT
TAATTAAGAGGTAAAGATAAAGACATGAAAGTTGTGGATAACCCTCTGGAAGCTCCTCCA
GATGAAAGCATTGACAAATGGTTTGAAGCTATAATGATTGCTACTATAATTACTCCGATT
GACTATGCTAAGGGAGTTACAATCTTATGCGAAGAGAAAAGAGGATAAATGAAATCTCAA
GAATTTCTGAATAATTCCACAGTTGTGCACTTTACCTATGAAATACCTTTGGCTGAGCTT
GTTACTGATTTCTTTGACAAGCTTAAGTCAATATCCTCAGGATATGCATCTTTGGATTAT
GAATTTGTAAGATATGAGGAAGCATCAGTAGTAAAGGTTATCTTTCACTTGAATGGAGAT
CCAATAGATGCTCTCACTTTTCTTGTTCATGATTCAAGAGCAGTAGACTTCGCCAAGAGA
TACTGTGCAAAATTGAAAGATCTCTTGCCTGCATAGTTATTTAAGATTGCTATTTAAGGG
AAAATTGGTGGAAAAGTCATTGCCAGAGAAGATATCAAAGCACTGAGGAAAGATGTGACA
GCAAAATGCTATGGAGGAGATATTACGAGAAAGAAGAAACTCTTAGAAAAGTAAAAGGCT
GGTAAGAAGAAAATGAAGGCTAGAATGTTAGGCTAAATTCCAGTAGATTCAGAGGTGTTT
TTGGGACTGCTAAAGCAAAGTTGA


>Contig2623.0.g78(protein)
MFVPNLPSSKQFSNMNETNGEFKILINDTKTGGQQRILITNIQGTINKLTKEDHHQVLDT
LKVERDRGITVIAQTATMIYKYQGVDYLMNLIDTPGHVDFTYQVSRSIRACEGALLVVDA
TKGIQAQTISNFYQAFDAGLTIIPIINKIDLPAADVDATRQQLIEQFDFKEEEILYISAK
EGRNVMEVLNQTIERVSSPFPEKSRDELAKLPLKAFLFDARFVQSRGVSCLIKIMQGTLD
MQKLRNLMSYHRSKRYDLFELGIVQPNMVPIGILNPGQVGYFLSNMKSVQDAHIGDTFYD
EKYQKDSIEPFPGYATPQPMVFAGIYPEDPDDYEDLEKSLQKLCLTDGSVSFNYESSAAL
GSGFRCGFLGMLHLDVFRQRLDDEHDMVSIITAPTVSYRVQLRGKDKDMKVVDNPLEAPP
DESIDKWFEAIMIATIITPIDYAKGVTILCEEKRGQMKSQEFLNNSTVVHFTYEIPLAEL
VTDFFDKLKSISSGYASLDYEFVRYEEASVVKVIFHLNGDPIDALTFLVHDSRAVDFAKR
YCAKLKDLLPAQLFKIAIQGKIGGKVIAREDIKALRKDVTAKCYGGDITRKKKLLEKQKA
GKKKMKARMLGQIPVDSEVFLGLLKQS