Identifiers and Description

Gene Model Identifier

Contig9600.0.g89

Standard Name

GTSF1c

Aliases

Contig9600_0_g89

Description

U11-48K-like CHHC zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05253 ) U11-48K-like CHHC zinc finger
  • ( pfam11193 ) Protein of unknown function (DUF2812)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012996800.0000009995106777214876hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9600.0.g89(coding)
ATGCGCAGATTCGATAACCCAAAAGTAGAATGCCCCTTTAACAAGCTACATGTAGTCCAG
AAACCAAGATTAGTCTGGCACCTGTAGAAATGCCCAGATATGTAGAAGTATATCCTGGAG
CATGGGGGCTATGAGAACATTAACAACATTTTATTCAGATGCAAATACAACTATGTTCAC
ATATTCTTTGACTCAGAAAGCAGAGATAAACATGAAATGGGAACTGACTGCGAAGACAAT
AATGAGGAGATGAAGAGACTCAAGAAAGAAAGAGATGAGCAGGATGATTGGGGCCTGCAT
GATAGCTAAAATGCAGTGAATGATCAGAGCAATACTTAACAGAGTACTAATTCATCACTC
GATGACACAGATATTGGTTGGGGTCAGTAGCCTATTCTATCACAAACTACAGTAAACACA
CAGAGCAATGTCAACAATATATGGAGTGATGAAAACGATAATCATGATTGGTGGACTGGA
GGAAAGTAGTCACAGCAGAGGAAATAAAAGCAGGCATATTCATATTTCAGCATTGATGGC
ATGGATTTCAACAGTGATGACATTAATACAGTAACAAAACCCATCAAAATATTTACAGAA
AAATAATCTAATTCACTATAGAACATGCATAACATTGACATGAGTGGGGCTAATGCAAAC
AATATGGATGTGGATTTGAACAATACAGATAAAAATCAAAGTGTGAATACTACTAATCAA
GAATAAGATGCCACTATTATATTAGAAGGTAAGATTAGGAAATCTGATTAAGTAGATAAT
TTATAACCTCAACAATATGATAAATAAGAGGATACTGGTTTATCATTTCTAGAGTTTATT
GAGTATAACTGA


>Contig9600.0.g89(protein)
MRRFDNPKVECPFNKLHVVQKPRLVWHLQKCPDMQKYILEHGGYENINNILFRCKYNYVH
IFFDSESRDKHEMGTDCEDNNEEMKRLKKERDEQDDWGLHDSQNAVNDQSNTQQSTNSSL
DDTDIGWGQQPILSQTTVNTQSNVNNIWSDENDNHDWWTGGKQSQQRKQKQAYSYFSIDG
MDFNSDDINTVTKPIKIFTEKQSNSLQNMHNIDMSGANANNMDVDLNNTDKNQSVNTTNQ
EQDATIILEGKIRKSDQVDNLQPQQYDKQEDTGLSFLEFIEYN