Identifiers and Description

Gene Model Identifier

Contig3956.0.g13

Standard Name

GTSF1b

Aliases

Contig3956_0_g13

Description

U11-48K-like CHHC zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam05253 ) U11-48K-like CHHC zinc finger
  • ( pfam11193 ) Protein of unknown function (DUF2812)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012996800.0000020007268868677913hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3956.0.g13(coding)
ATGCGCAGATTCGATAACCCAAAAGTAGAATGCCCCTTTAACAAGCTACATGTAGTCCAG
AAACCAAGATTAGTCTGGCACCTGTAGAAATGCCCAGATATGTAGAAGTATATCCTGGAG
CATGGGGGCTATGAGAACATTAACAACATTTTATTCAGATGCAAATACAACTATGTTCAC
ATATTCTTTGACTCAGAAAGCAGAGATAAACATGAAATGGGAACTGACTGCGAAGACAAT
AATGAGGAGATGAAGAGACTCAAGAAAGAAAGAGATGAGCAGGATGATTGGGGCCTGCAT
GATAGCTAAAATGCAGTGAATGATCAGAGCAATACTTAACAGAGCACTAATTCATCACTC
GATGACACAGATATTGGTTGGGGTCACCAGCCTATTCTATCACAAACTACAGAAAACACA
CAGAGCAATGTCAACAATATATGGAGTGATGAAAACGATAATCATGATTGGTGGACTGGA
GGAAAGTAGTCACAGCAGAGGAAATAAAAACAGGCATATTCATATTTCAGCATTGATGGC
ATGGATTTCAACAGTGATGATATTAATAGAAACATACATAACATTGACATGAGTGGGGCT
AATGCAAACAATATGGATGTGGATTTGAACAATACAGATAAAAATCAAAGTGTTAATACT
ACTAATCAAGAATAAGATGCTACTATTATATTAGAAGAGTACTTTAGGCTTTTGTAGTTA
AACTGA


>Contig3956.0.g13(protein)
MRRFDNPKVECPFNKLHVVQKPRLVWHLQKCPDMQKYILEHGGYENINNILFRCKYNYVH
IFFDSESRDKHEMGTDCEDNNEEMKRLKKERDEQDDWGLHDSQNAVNDQSNTQQSTNSSL
DDTDIGWGHQPILSQTTENTQSNVNNIWSDENDNHDWWTGGKQSQQRKQKQAYSYFSIDG
MDFNSDDINRNIHNIDMSGANANNMDVDLNNTDKNQSVNTTNQEQDATIILEEYFRLLQL
N