Identifiers and Description

Gene Model Identifier

Contig9792.0.g69

Standard Name

GTSF1a

Aliases

Contig9792_0_g69

Description

U11-48K-like CHHC zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam05253 ) U11-48K-like CHHC zinc finger
  • ( pfam08755 ) Hemimethylated DNA-binding protein YccV like

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9792.0.g69(coding)
ATGAGAAAATATGATGCACCTCAAGTCATTTGTCCTTTTGACAAAAGCCACTTTATGCCC
TTGTAGAGATTGCAGTTTCACTAGCCTAAGTGTGAGCTACAGTTTATCAAGAATAATCCT
GGAGCAATCGTCTTTCACTGCAAACATCACTTTCAACATGTCTTCTTTGATGTTGATTCT
TTGAAGAAGCATGAGACAGAGGAATGCCAGTCAAGACCTGAGACAATTCGTGCGAGAGCT
AAGAAATAAGAGCAAGAGCACATCTAGGATAGAGAGCATAGATGGAGAGATAGCGATGAA
GAAAAGAAACTCCCATTGAAGTAGAGAGAGCAAATCAAAGTTAGAGATGTGAAGAGGACT
TCAGCTACAAAGGAATTCACTCTAGGTATTTCATCTCCGCTTATGATCGAAGCAAAGCTT
GCCAAGAATTCTACTGAGAAAAACCAAATCCTTGGAAAAAGATATCAAGTTATGGACCCT
AGACTCACTCTCACAAACCCTCATGATGCTACCAAAAGAATGAAACTCTAAAATTTGACT
GCTAAAACTTCATCATCAGCTACTTCAAAGAGTCAATTGTTGTCAAAATCAGGGTAATCA
GGTATTTTAAATCTCAAGAAAGAAAACTTAAGTCCCTAAATTGGATAGCTTGATGTGAAA
AATTCGTTGAAGTTAAGTGTAATGCAACTTGACTTGGGCAGATCTCCATTTATAAACGTT
CCCTCTGATTCAAATAGCAGCTATAACAATTCAGCTATCTTTAGCCCTATCTAGTGA


>Contig9792.0.g69(protein)
MRKYDAPQVICPFDKSHFMPLQRLQFHQPKCELQFIKNNPGAIVFHCKHHFQHVFFDVDS
LKKHETEECQSRPETIRARAKKQEQEHIQDREHRWRDSDEEKKLPLKQREQIKVRDVKRT
SATKEFTLGISSPLMIEAKLAKNSTEKNQILGKRYQVMDPRLTLTNPHDATKRMKLQNLT
AKTSSSATSKSQLLSKSGQSGILNLKKENLSPQIGQLDVKNSLKLSVMQLDLGRSPFINV
PSDSNSSYNNSAIFSPIQ