Identifiers and Description

Gene Model Identifier

Contig18025.0.g11

Standard Name

GTPBP3

Aliases

Contig18025_0_g11

Description

GTP-binding protein TrmE N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006898301.0004883026569571e-88small GTP-binding protein doma
in containing p...
SGDYMR023C5.9981191891941984e-64MSS1 SGDID:S000004625, Chr XII
I from 321017-319437, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18025.0.g11(coding)
ATGTATTTAAATAAATTTATCCACAAAAGACTCTCGAAGCAAATTAACACATAGCTACTT
TACTAAAACTATCTTCTCAGATATTTCTCTAATACAAATAAAAGTTAATTGGTTTTCAAG
GACACTGTTTATGCTTTGAGTACTGGATTCGGAAAATCAGCAATAGCTGTTATCAGACTA
ACTGGAGATTCAGCTACAGATGCTTTGAAATTAACGCTACCAATAAATTATAATCATGAG
AGTTATCAAGAAGAAAGCGATATGAAATTTAGAGAAATAAAAGACAAGGTTAAGCCTAGA
TATGCGCATTACAGAAAGTTTTACAATGTTTTTAGTGATTAGCCTGTCAATAACATCATT
GATGAGGGAATCATGCTATATTTTAAAGGTCCAAATTCTTTTACTGGTGAAGATATGATT
GAATTTTAGATTCATGGTGGAAACGCTGTAAAATAATAAATGTTATCAACTCTGAGTAAG
TTCCCTACTTTTAGATAAGCTGAGCCTGGAGAGTTCACTAAACGTGCTTATATGAATGGA
AAATTAGACTTAGTAAAAGCTGAGGGCTTGAACGACTTAATAAACGCATAATCAGAAGAA
CAACTCAAGCTCTCCATGCATTAGCTCTTAGGACGTCACTCTTTACTTTATGAAGATCTT
AGACAATAACTGATTAGAATGTTGGCTCATGCTGAGGCCTATATAGATTTTGAAGCTGAT
GAAACCAACGATTTGCTGCCATAAGTGTTCATTGATTTAGGCAAAAGTACAGAACTACTT
TCCAAACAAATTGAGGGCTATTTAAGAGATGCAAATATTGGAGAAACCATCAGAGAAGGG
TTTAAGATTTCAATTTTAGGACCCCCAAATGCTGGAAAAAGCACCTTGATGAATCTGTTA
ACTAAAAGAAGAGTTGCTATTGTTAGTGAAATCCCAGGTACCACAAGAGATCTAATTAGC
ACTAATATTAACCTCTTTGGTTATAATGTCATTCTTACTGATACTGCAGGATTGAGAGAT
TAAACCAAAGATTCTATTGAGAAATAGGGTATTGATATGGCCATGGAAGAGTCCCAGAAA
AGTCATGGAGTTATTTTCTTGCTTGATATACAAGATTTAGAGAGAGAAGAATTATTTCCA
GATATGCTAGTGGAAGAGCTGAGAGCTGCTATTCATTGCATAGGCCGTATAACTGGGAAA
GTGGATGTTGAAGATGTATTGGATGTGCTTTTTAGGGAATTTTGCATTGGAAAGTGA


>Contig18025.0.g11(protein)
MYLNKFIHKRLSKQINTQLLYQNYLLRYFSNTNKSQLVFKDTVYALSTGFGKSAIAVIRL
TGDSATDALKLTLPINYNHESYQEESDMKFREIKDKVKPRYAHYRKFYNVFSDQPVNNII
DEGIMLYFKGPNSFTGEDMIEFQIHGGNAVKQQMLSTLSKFPTFRQAEPGEFTKRAYMNG
KLDLVKAEGLNDLINAQSEEQLKLSMHQLLGRHSLLYEDLRQQLIRMLAHAEAYIDFEAD
ETNDLLPQVFIDLGKSTELLSKQIEGYLRDANIGETIREGFKISILGPPNAGKSTLMNLL
TKRRVAIVSEIPGTTRDLISTNINLFGYNVILTDTAGLRDQTKDSIEKQGIDMAMEESQK
SHGVIFLLDIQDLEREELFPDMLVEELRAAIHCIGRITGKVDVEDVLDVLFREFCIGK