Identifiers and Description

Gene Model Identifier

Contig11849.0.g52

Standard Name

GTF2H5

Aliases

Contig11849_0_g52

Description

Transcription factor TFIIH complex subunit Tfb5

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam06331 ) Transcription factor TFIIH complex subunit Tfb5

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11849.0.g52(coding)
ATGCCTAAAACTAAAAAGGGAATTCTCATTACCACAGATGTAGCAACTAAGATCTACCTG
ATGCAGCAAAGAGAGAATTTCATTATCAAGGACATAGATGAGTACTCGCTATTCATAGAA
GAAAGCAAGATCGACTGGGTGAAGGAAAAAGTCATCGAATTCAAAAATAAATATAGCTAC
GAGAAACCACAGTCAGAGCAGACTGCAAAGAATAAGAATTGA


>Contig11849.0.g52(protein)
MPKTKKGILITTDVATKIYLMQQRENFIIKDIDEYSLFIEESKIDWVKEKVIEFKNKYSY
EKPQSEQTAKNKN