Identifiers and Description

Gene Model Identifier

Contig7824.0.g105

Standard Name

GTF2H4

Aliases

Contig7824_0_g105

Description

Transcription factor Tfb2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam03849 ) Transcription factor Tfb2
  • ( pfam13625 ) Helicase conserved C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL122C2.0008113830639685e-30TFB2 SGDID:S000006043, Chr XVI
from 320767-319226, Geno...
T. thermophilaTTHERM_003132900.0000000006999585478469937hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7824.0.g105(coding)
ATGTTGCACATTAGACCTAAAAGTTAGTCAATTGGAAGTTAAGGAGGCTCCATTGCTACC
AATGAAGAGCTTAATTAAGCAAAGAAAGATAAAGATAGCTTGGCTGAAAAGTTTATCAGC
AAGTTAATGAGATTGGATCTTGCTTAAGAAGTGGAAAGTGGTTAAGGGCTCATTGGTACT
CCTGGAGTAGGAGGGGCTTCGTAATCAAGAACTCCTAGAATTCCAACATTAAATCAAAAC
TTTAGCACAATGTCTACGGGAGCTGCTGGTTAAACATCCGGAACACCATAACTTGGTCTC
TATTAATACGGAAGCAGCTTTATGGATGGTGAGAGGGAAGCACAGAACAGAAAAAGCTAC
AGACTCAATAAAGAATTTCTCAATAACGTTATCGATATATTGACTACAAAGTTTGAGCTG
ACTAGATTGAAAGAAAAAAAGAAAATAAAGAACTAAGCCCAGCTTGATACAGCTTCTTAA
ACTAAGTGGGAAAACATATCTAAATTCATGCTGAATATTATCCCTCCTTAGTAAAATACT
CCAAAATCATTGATCAATCTGCTTTAATAAGCTAGATACATTGAATTTGATGTGAATGCT
TAAACTTATTAACTTACTGTCAATGGATTTTAGTATATATTGATGGACATCGCTTCTCAA
GTTTAAAATATATTGTTAAACTATATTCAAACTGCAGAAACTTCTGGAAGAAATGTGGTT
GAAGTATTAGGGTTTATATTCAATTTGACACTCACAGAGCCAAATTATGATGGAAACGAA
AATGTGAATAGTATTTTAAGAGACTTTGATGATATGGGTTTAGTAGGTATGGAGAGAAGA
TAGAAATTCGTAATCACATCTCTTCTACAATCATTTCTCCAATCTCAAACAGGTCAACTT
TAAAAATCTTCTGACTCCTCTTCTTCTAATGTGATTGACGCTTAAAGATCCCAGTCTCAA
GATAAATTTTTGATTGTTGAGACAAACTTCAAAGTTTACGCATATACCTCTAGTGACCTT
TATAGAGCTCTTTTGAGACAGTTTATCCGAGTAGAGTGTATTTTCCCTAATTTAGTTGTT
GGAACTTTGACCAGGAAATCACTTTAAAAAGCCTTTCAAAGAGGAATATCGTCTGGGCAA
ATTCTCTCATTTTTAGAGAGTCATATTCATTTGACTGCAAGATTGAACAAATTAGTCTAA
CAGTAGAATAATATGGCTATGGCTCAAGGCAGCATTAATGATTTTGGACTTAAAAATAGA
GGATTAATGGCATCAGGTGATTAGAAAAATATACCCATTGCTGATTTGTTTGGACTTAGT
AGCTCTAAGTTAAAGAAATAGAAAGCTTCGAATCAAGAAACTTACTCATTCATTCCACCA
AATGTGCGCTAATAAGTAGAACTCTGGGAAAAAGAACTGAAATCTCTTAAAACAGCCCCA
GGATTATTGATAGAATTTGAATCTCAGAAAGAGTATGGGAGTTTCTTAGAGCATGCAATT
AAAAATAAGATTAGTATAATGAAGAAAATTGACTAGAAAATGCTTGTTGTCGTTGATGTC
AAAAACGAGAAGTAGGCCTATGATTTTATATTTAAATGA


>Contig7824.0.g105(protein)
MLHIRPKSQSIGSQGGSIATNEELNQAKKDKDSLAEKFISKLMRLDLAQEVESGQGLIGT
PGVGGASQSRTPRIPTLNQNFSTMSTGAAGQTSGTPQLGLYQYGSSFMDGEREAQNRKSY
RLNKEFLNNVIDILTTKFELTRLKEKKKIKNQAQLDTASQTKWENISKFMLNIIPPQQNT
PKSLINLLQQARYIEFDVNAQTYQLTVNGFQYILMDIASQVQNILLNYIQTAETSGRNVV
EVLGFIFNLTLTEPNYDGNENVNSILRDFDDMGLVGMERRQKFVITSLLQSFLQSQTGQL
QKSSDSSSSNVIDAQRSQSQDKFLIVETNFKVYAYTSSDLYRALLRQFIRVECIFPNLVV
GTLTRKSLQKAFQRGISSGQILSFLESHIHLTARLNKLVQQQNNMAMAQGSINDFGLKNR
GLMASGDQKNIPIADLFGLSSSKLKKQKASNQETYSFIPPNVRQQVELWEKELKSLKTAP
GLLIEFESQKEYGSFLEHAIKNKISIMKKIDQKMLVVVDVKNEKQAYDFIFK