Identifiers and Description

Gene Model Identifier

Contig14857.0.g41

Standard Name

GTF2H2C

Aliases

Contig14857_0_g41

Description

Ssl1-like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR005W1.9992362000979228e-56SSL1 SGDID:S000003995, Chr XII
from 160049-161434, Geno...
T. thermophilaTTHERM_001520501.9991939848149086e-44transcription factor ssl1 fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14857.0.g41(coding)
ATGGCAAAATAGCAGTCTTATGCTTGGGAAAAGGATATTTCAGCTAGGTGGAAAACTTTG
AAGGAGGCCGATATATCAGAGTTCTATGAATCAGAATAATCTCAAAAACTGCATAAAAAA
GAGGCTATTGATAAGTTCAACTAATCAATCAAGAGGAAATCGCTAATTAGATATCTGACC
GTAGTCATTGACTTTTCAAGTGCTGCCAAGAAACAAGAAATGAGACCTAATAGAGCAATA
GTTATAAAGAGCTATCTTTCAAACTTTGTCATTGACTATTTCGATCAAAATCCCCTATCA
TGTCTAAGTTTTGTTGCCACTTTTAGAGAAAGGGCTATAATACTCTCTGATTTCAATGAC
TCTCCTCAAGATCATATTGAAAAGATTTGCAGGTTTTCAGATTTAGAGGGAAATGCCTCT
ATTTAAAACTCGCTAGAACTATGCATTGAGAATTTTACCGCAGTCCCTTCTTATGCGAAA
AAGGAAATATTGATCATATTTTGCAGCATTACAAACTGTGACCCAGGAAATATCTTTGAA
ACCTATGATAAATTAAAGTCAAAAATGATAACATGCTCGGTTATTTCACTTTCAGCATCT
ATGTTCATTCTTTAAAAAGTGACTTAACTCACAGGAGGAGAGTTTTTCCTATCCAAAGAT
TAAGCTCATTTCTAAGATTTGCTAAAGAGGCTACTTGTTCCTAAAGAATCAATTGAGGAT
TTAACGTAGAGAAAGCAATAGTAAAACACCCTGATTAAAATGGGCTTTCCTATGAGGAAA
ATTCTGAGTTATCCTGCAGTTTGCTCGTGCCACAATGATCTGAGATTCCTTGTATATATT
TGCCCAAATTGTCAATCACCATCATGCGAGTTATCTTCTTTCTGTAAAGTGTGCCAGATT
ATGTTAGTGAGTGCGGCTCATTTGTCTAGGACTGCTTAACACAATCAAAACTTGGCAAAC
TTTCAGAGACTTACAGATTACTTAAAAGTAGAAACTGTATAGAATTAAGATACCAAAATG
ATATCAGATAATAATCAGATCAATGACGCACCCCTAGTTAATGGACAGGATGTACAAATG
AGATCAGACTATGATTTATCTCAAACTAATAATTAAGAAACCACGATTATCTCCTCAGTT
GGAAATTTAATCTAAGATCATTCAATGAACAATCTAGACAGAAAGAGCAATGATCAAACA
AATGGGCTAATCTAATAATAGTATCAGCAACCTAACTCTCAGTAATCTTTCGAAAGGAAC
CTTGATATGTCCAAGATCAACGAGATATTCCCGCTTAACAGCATGAAAACAGTGGGCTCT
ATACTTTAAAAGGACGGTCACTCCTATTATTGCAATGGCTGTTCTAAACGCGTTGAGGCT
TCATTTGATAACGTAGATATAGTAATCTGTACGATTTGCAAGAAATTCTATTGCCTGGAC
TGTGATATTTTCATTCATGAGACCTTATTGAGCTGCCCTACTTGCCAACTAATTTAATGA


>Contig14857.0.g41(protein)
MAKQQSYAWEKDISARWKTLKEADISEFYESEQSQKLHKKEAIDKFNQSIKRKSLIRYLT
VVIDFSSAAKKQEMRPNRAIVIKSYLSNFVIDYFDQNPLSCLSFVATFRERAIILSDFND
SPQDHIEKICRFSDLEGNASIQNSLELCIENFTAVPSYAKKEILIIFCSITNCDPGNIFE
TYDKLKSKMITCSVISLSASMFILQKVTQLTGGEFFLSKDQAHFQDLLKRLLVPKESIED
LTQRKQQQNTLIKMGFPMRKILSYPAVCSCHNDLRFLVYICPNCQSPSCELSSFCKVCQI
MLVSAAHLSRTAQHNQNLANFQRLTDYLKVETVQNQDTKMISDNNQINDAPLVNGQDVQM
RSDYDLSQTNNQETTIISSVGNLIQDHSMNNLDRKSNDQTNGLIQQQYQQPNSQQSFERN
LDMSKINEIFPLNSMKTVGSILQKDGHSYYCNGCSKRVEASFDNVDIVICTICKKFYCLD
CDIFIHETLLSCPTCQLIQ