Identifiers and Description

Gene Model Identifier

Contig15803.0.g96

Standard Name

GTF2F2

Aliases

Contig15803_0_g96

Description

Transcription initiation factor IIF, beta subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02270 ) Transcription initiation factor IIF, beta subunit
  • ( pfam03065 ) Glycosyl hydrolase family 57

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15803.0.g96(coding)
ATGAGCTAATAGGGATCACAATATAACATGCCCAATCCATTAATCAAGCACAATCAAATA
TTTTACTTCAGAGTGCCCACTTAAATGAGGTACATATTTGAAAACCCAGAAAACCTGAAC
AATTAAGACTGTCTTGGCGAGGTCCTAATTAAATAATCAGATCCTTCTGTCGCACCTGAG
ATGTTTGTTACACTGCTTAAAAGAAGAAAAGTGGATAATTAAGACAGTGGGAGCTATGGC
AGTAAAAACAGTAGTACGAAGACAGAGTAATTATCTTTTAAGTGCTAGGACATCTCAGAT
AAAAACGCAATCAGATACATCATGAAAGCTTAAGACAGTGGAGTTACCAGAGAATAATAA
AACATGAAGTCTTCATCGAGTCACAATAAAAGATTGAACAAAGCAAAATTAAAGGGTAGA
TTGACTAAGACCCTGCAAATGATACCTCAACAAAAAATTGATGTTATAGAGATTAAGTAA
GACACAGTCTCTATCGAATCCATCGACAAGCCTCCAGAAGTGTTTTTGCAACAGAGCGTC
TTTGACATCAGATAGAAACAAGGTACAGGGTAACCTGGCTAGGAAACTATTTTGTCTGGA
GCAGCAGCTTCTTAAAGACAGCAACCCAAGGAAAAGAGATTCGCTATGGATTAAGGAGAC
TTGAAAATGGAGATCTTTGGGTTATTCCAGAAGTATTATCAGTACACTCTAGAAGACATC
TAAAACATTCTCAATCAGCCAAGAGACCCAGTGAAGAAAGTTCTTGAGGAAATTTGCGAA
TTGAATAGAAACACCAGATTCTACGAATTAAAGAGAAGCTATACATGA


>Contig15803.0.g96(protein)
MSQQGSQYNMPNPLIKHNQIFYFRVPTQMRYIFENPENLNNQDCLGEVLIKQSDPSVAPE
MFVTLLKRRKVDNQDSGSYGSKNSSTKTEQLSFKCQDISDKNAIRYIMKAQDSGVTREQQ
NMKSSSSHNKRLNKAKLKGRLTKTLQMIPQQKIDVIEIKQDTVSIESIDKPPEVFLQQSV
FDIRQKQGTGQPGQETILSGAAASQRQQPKEKRFAMDQGDLKMEIFGLFQKYYQYTLEDI
QNILNQPRDPVKKVLEEICELNRNTRFYELKRSYT