Identifiers and Description

Gene Model Identifier

Contig4998.0.g90

Standard Name

GTF2B

Aliases

Contig4998_0_g90

Description

Transcription factor TFIIB repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00382 ) Transcription factor TFIIB repeat
  • ( pfam08271 ) TFIIB zinc-binding
  • ( pfam08280 ) M protein trans-acting positive regulator (MGA) HTH domain
  • ( pfam08792 ) A2L zinc ribbon domain
  • ( pfam08421 ) Putative zinc binding domain
  • ( pfam02591 ) Putative zinc ribbon domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR086W1.9994920269952867e-34SUA7 SGDID:S000006290, Chr XVI
from 710101-711138, Geno...
T. thermophilaTTHERM_007846200.000030009396760408108hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4998.0.g90(coding)
ATGACATCCCAATCATAACAACTCAACAATACATCAACATCATCCTCAACTTCTAATTAG
CCAGTATTTTAAGTCCCTATGAACAGGGGACCAACTTAGCCCACTCAAGATAGACAACAA
TTATAACAATAAGTAGGAAATTAAAATCAGACTAGGATTGATAATTTCTAGCCACCTATC
AGACCCTTGAAGTTAAGAATTCAGTAGAAGCAAGAAGAGAAGGAGGAAAAGATAATAAAG
AAAATTCAGAATAACCATTCAATTGACAGGTGCGATGAGTGCAAGAGAGCCATGCTTGTG
ACTAACCACGTAGAGGGCACTTTGGTTTGCCAAGGTTGTGGACTAGTTTAGCTTTCCCGC
ATCATTGATGACAGTTCAGAGTGGAGAACATTTTCAAGTGAAACTTCAAATGGAGGTAGT
AACCCAAGCAGAGTGGGTGGTAAACTCAATCCCTATTTATCTAATCACGGTATTGACACC
CAAGTGACTGGTAAAGGAGCTAGTGAGATTCAGAAATGGAGTGATAGATCCTCTTTGACT
GCAAAGGACAAACTCATCACTCAAGGGTTGAGAATGATTAAGGAACAAGCTCATTTACTC
AACTTAAAGGAAGCAGCCATCACCAAGGCATCTGAGATTTATAAAGAAATTGAAGATAGA
GGTATTCTCAAGGGAAAGAGTGTTAAGGGAAAGGTCGCTGGAGCTATCTTCTTTGCTAGT
AGATTAGTTGGTCAACCCAAATCCCTAAAGCACATCCTTTCTGCAACTGAAGTAACTGTG
AAAGAATTGAACAGTTGTTTGAAGAGAATCAGAGAGCTTTTCCCTGATGAGAGAGTAACC
ATCACTTCCAAGGATATTGCCAGACAAGCATGCAACAGACTGGGCTTAGCAATGGACGTG
GTCTATGCTGCTGAGATGACAGCTGAGAATATCACTAATTTGGAGATTGCCACTGGCAGA
TAGCCCCAAACTATTGCTGGAGTTGCCATTTTCATAATCACTTAACTTTCAGTTGACAAG
AAAAGTTGTGCCGATATTGCCAATGGAGTGCAAATTACTGAACAGACCATCAAGCAAGCT
TACAAGGATATCTATGAGTATCGCCACTAGATTCTACCTGTAGCCTGGAAGTCCAAGGAG
CCAATCGAATCACTCATTAGACCATGA


>Contig4998.0.g90(protein)
MTSQSQQLNNTSTSSSTSNQPVFQVPMNRGPTQPTQDRQQLQQQVGNQNQTRIDNFQPPI
RPLKLRIQQKQEEKEEKIIKKIQNNHSIDRCDECKRAMLVTNHVEGTLVCQGCGLVQLSR
IIDDSSEWRTFSSETSNGGSNPSRVGGKLNPYLSNHGIDTQVTGKGASEIQKWSDRSSLT
AKDKLITQGLRMIKEQAHLLNLKEAAITKASEIYKEIEDRGILKGKSVKGKVAGAIFFAS
RLVGQPKSLKHILSATEVTVKELNSCLKRIRELFPDERVTITSKDIARQACNRLGLAMDV
VYAAEMTAENITNLEIATGRQPQTIAGVAIFIITQLSVDKKSCADIANGVQITEQTIKQA
YKDIYEYRHQILPVAWKSKEPIESLIRP