Identifiers and Description

Gene Model Identifier

Contig14147.0.g88

Standard Name

GTF2A2

Aliases

Contig14147_0_g88

Description

Transcription initiation factor IIA, gamma subunit, helical domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam02268 ) Transcription initiation factor IIA, gamma subunit, helical domain
  • ( pfam02751 ) Transcription initiation factor IIA, gamma subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL058W0.0000000000010000211161514907TOA2 SGDID:S000001541, Chr XI
from 330166-330534, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14147.0.g88(coding)
ATGTCCCAGCTAACTATCTACAGAGAGACAACTATAGGCGCTGCCCTTAAGGATTCTCTA
AAGGAACTTGAAACTCAAATCGGCGAAGAACTCATCGGTAAAGTCTTAGAATCATTCGAT
GCAGTGATATGCGATAGATTTAAGGAGGTAAACTCCAATAACAAGTGCAAACTCCAAGGA
AAATGCATTTCTTACAATAATTGCGATGATGTGTGGCTTTTCCTACTCGATAGCTGTAGC
ATCAAAGGAGACGATATTGACGAAAGTGCTAAAAATTGTCGCATTGTTGCTACTGATACT
GCTAATAAAGAAGGCAATGCAAGACGTGAACCTGTGAGAAGAAATCAGAAGGGCGCGAAA
GGCCACAGACGAGGTGGTCAGAGACAGTGA


>Contig14147.0.g88(protein)
MSQLTIYRETTIGAALKDSLKELETQIGEELIGKVLESFDAVICDRFKEVNSNNKCKLQG
KCISYNNCDDVWLFLLDSCSIKGDDIDESAKNCRIVATDTANKEGNARREPVRRNQKGAK
GHRRGGQRQ