Identifiers and Description

Gene Model Identifier

Contig16298.0.g16

Standard Name

GSPT2

Aliases

Contig16298_0_g16

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03143 ) Elongation factor Tu C-terminal domain
  • ( pfam03144 ) Elongation factor Tu domain 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001464107.997561032467517e-125Elongation factor Tu C-termina
l domain contai...
SGDYDR172W9.995516318087232e-125SUP35 SGDID:S000002579, Chr IV
from 808324-810381, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16298.0.g16(coding)
ATGTAGAATCAAGGTTACGACTAAATCTTTGCAGGAGGATCTCAAGGTAAATAAAACCTT
GTAAATACTAACTTCCCATCACTCGGTGGTGGAGTTCAAGCTTAAGCTAATGTTGGAGGG
TAATAAACCAATGCAAACTTCTAAATGCAAGGATAATTCAATCAACAATAATAGCATATG
AGCGGTATGGGTTATCAAGATTTTAATCAGCAACCATTCTATCAATAACCAAACCAATTT
TAATAGCCAGTAGGCAATCAACAATGGGGAATGCAACAGAATCAAATGTACAACACTATG
CCAATGGTTGATCAATTTGGACAATAGGTGTTTGATCAATTTGGAAATGTTATGTATCAA
TAGCCAGGTGCATTCGCTCAGCAATAATTTGTCGGTTTAGGTTAAACTTAGAGCATGACT
AATGCTATTGGTAGCATGAGCTTAGGAAATGATATGCCACCAATTGGAATGACTTCAAGT
GCCCCAATTACCAACCTAGCAGGTGCAAACACAGCTGCAAGTTCTCTTGGTTCCACCTAA
TCAGCTGGCACTACATCTACTACAACACTCAACACTGGCTCTTCTTCTTTCGTTCCTAAG
AAGAAAATCGTGAAGACTGAGGAAGCTTTCCCCACTCTCGGTATGTCAGAAGCTCCAAAG
AAAAAGGCAGCTACATAAAAGAAGGAAGATGATCAACCAAAGAAGTCAGCTGATCCATGC
CAAGGAAAAGCTAAAGAGTTCTTCACACTTGTTCCAGTTAATCCTATGTTCCCTGCTGAT
CCCTTTGCAAACCCTCTTACTCCAAGTGATGAGCAATTGAAGTTTATGTTCATCAATTAC
CCAGAATATGCCCCTAACCCAGTTGATTTATTCATCTGGCTCTACAGCTATGCTCAATAC
AATGAAGAGTAAATCAAGTATCAAAAGCAGATGCAAGAAACTGATGGTGCTTACAAGTCA
AAGCCCAAGATCGGTGCTCGTGGAGTTAAAGGCAAGGGAAAGAAGAATCAAGATGAGGAA
GACGAAGAAGAAGACACTTTCTATTTTGATAAAAACAGACTTAAAAAGCCTGCTGCCCCA
CCCGCTCAACCTAAAGTTGTTCAAGAAGATCCAGAGAAAAAGAGACTTCGTGAATAGAAA
AACGCTGAGGCACTCGCTAAAAAGAGACAGAAAGAGGCAACTAAGGGTATTAAGAAGGTT
ACTACTCAAGTTGTTGACGAAGAAGTCATAGATGTTGATGAAACCAGACAACCAGCAAGT
TTAGTATTTATTGGTCACGTCGACGCAGGTAAATCAACCATTTCTGGTAACTTGATGTAC
TTGATGGGAGCTGTCGATCAAAGAACCATTCAAAAGTACAAAGAAGAAGCTAAGGAAAAG
AACAGAGAGTCTTGGTGGTTAGCTTATGTTATGGACGTCAGTGAAGAAGAAAAAGCTAAG
GGTAAAACTGTCGAAGTTGGAAGAGCTAACATTGAAACTCCCAAGAAAAGATGGACCATT
TTTGATGCTCCAGGCCATAAGAATTATGTACCAAACATGATTATGGGTGCTGCTCTTGCT
GATTTTGGAGCACTTGTTATTTCAGCCAAAAAGGGAGAATTCGAATCAGGATTCGAAATG
GAAGGTCAAACCAGAGAACATATTCAACTTGCCAAGAGTTTAGGTATCTCTAAAATTGTT
GTTGCTGTCAACAAGATGGATGAGCCTAGTGTAAAATGGAGCAAGGATAGATACACAGAA
ATCATCAATGGATTGAAGCCATTCATGCAAGGCTGTGGTTATGACCCAGAAAAGGATATC
GTATTTGTCCCTATCTCAGGTCTTAATGGCGATAATCTTAAAGATCCAATTAATAAAGCT
GTTTGCAATTGGTATCAAGGACCAACTCTCTTGGAAATCTTGGATGATCTCGAAATGCCA
GCAAGAGACCCTGAGGGCCCATTGAGAATCCCAGTACTCGATAAAATGAAGGATAGAGGA
ACAGTTATGTTTGGAAAGGTTGAGTCAGGAACTGTCAAGCTTGGAGATCAGTTAGCTGTT
ATGCCTACTAACCTATTGGCTTAAGTCCAGACTATTTATAATTCAAAGGGTGAGAGTGTA
AGATACGCTAAACCAGGTGAAAATGTTCAACTTAGACTTGGCAACATCAATGACGAAAAT
ATGATAAATAAGGGTGATGTCTTATGCAGAATGAACGAACAAACTGCAGTCTCAGATCTA
TTTGAAGTTGAACTTGATGTTCTTGAGCTTTTGAAATATAAGCCAATTTTATCCAAGGGA
TATCAATTCATCTTGCACATTCATACTGTAGCTGAAGAAGCTTCTATTAAGGATCTTATC
AGTTCAGTCGAAAAGAACGATAAGGGAGATGCCGTTGAGAAATTGAAGCCTCAATTCGTT
CAAAGCTATGCTAAGGTTATTTGCAGAATCTAAACCAGAGTTCCAATTCCCCTTGAAAAG
TTTGACTTCCTTCCTTAAATGGGTAGATTCACAATTAGAGACGAAGGTAAAACAATTGCG
GTTGGTAAGGTATTGAGATACAAGCCAGTTAAGATTCAATCATACATAACTCCATAAAAT
ACTCAAGCTACTGGCACTGCCACCGCAGGAGGTCAAATCACTGACGCTGCTTAAGCCAAC
TTGAACTTAGATGCTTCTGCAAAGACCGGCAAGCAAACTGAAGAACTTATCTTTGACATG
GAGTCTGGTGAGATGGTTACTAAAGAAGAGTTCCAACGTAGAAACAAGGAGAGAGAGGAG
ATGGAAGGAGTTGAAGAAGAAGACGAGGACGAGGAAGAGGACAACTGA


>Contig16298.0.g16(protein)
MQNQGYDQIFAGGSQGKQNLVNTNFPSLGGGVQAQANVGGQQTNANFQMQGQFNQQQQHM
SGMGYQDFNQQPFYQQPNQFQQPVGNQQWGMQQNQMYNTMPMVDQFGQQVFDQFGNVMYQ
QPGAFAQQQFVGLGQTQSMTNAIGSMSLGNDMPPIGMTSSAPITNLAGANTAASSLGSTQ
SAGTTSTTTLNTGSSSFVPKKKIVKTEEAFPTLGMSEAPKKKAATQKKEDDQPKKSADPC
QGKAKEFFTLVPVNPMFPADPFANPLTPSDEQLKFMFINYPEYAPNPVDLFIWLYSYAQY
NEEQIKYQKQMQETDGAYKSKPKIGARGVKGKGKKNQDEEDEEEDTFYFDKNRLKKPAAP
PAQPKVVQEDPEKKRLREQKNAEALAKKRQKEATKGIKKVTTQVVDEEVIDVDETRQPAS
LVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKEKNRESWWLAYVMDVSEEEKAK
GKTVEVGRANIETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEFESGFEM
EGQTREHIQLAKSLGISKIVVAVNKMDEPSVKWSKDRYTEIINGLKPFMQGCGYDPEKDI
VFVPISGLNGDNLKDPINKAVCNWYQGPTLLEILDDLEMPARDPEGPLRIPVLDKMKDRG
TVMFGKVESGTVKLGDQLAVMPTNLLAQVQTIYNSKGESVRYAKPGENVQLRLGNINDEN
MINKGDVLCRMNEQTAVSDLFEVELDVLELLKYKPILSKGYQFILHIHTVAEEASIKDLI
SSVEKNDKGDAVEKLKPQFVQSYAKVICRIQTRVPIPLEKFDFLPQMGRFTIRDEGKTIA
VGKVLRYKPVKIQSYITPQNTQATGTATAGGQITDAAQANLNLDASAKTGKQTEELIFDM
ESGEMVTKEEFQRRNKEREEMEGVEEEDEDEEEDN