Identifiers and Description

Gene Model Identifier

Contig21203.0.g38

Standard Name

GRWD1

Aliases

Contig21203_0_g38

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam12265 ) Histone-binding protein RBBP4 or subunit C of CAF1 complex

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004679106.998385540567102e-102hypothetical protein
SGDYMR131C8.003355238965419e-63RRB1 SGDID:S000004738, Chr XII
I from 534698-533163, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21203.0.g38(coding)
ATGGAAAGCACTAATAAAGCCAATAACAAAAAGCGCAGAAACGAAGAAGCCTCTCTATAG
GGTAGTGATGATGTTGACATGAGTGATGTAAACATGGATGATTAGCAATAGCAGTAAAGA
AAGATAGTGAAGGTAAAGAAGAGAGAACACAATCCCAATTCAATGATTCCTGAAGATGAG
GATGGCGATAATGGCGTGATTTACTCTGAGGATGAGTTCGAGGAGGAGATTATAGTCACT
AGAAAGAAGGGTGATGAAGAGTGGGAAGACGTAGATTCCAATGCAGACGATGAGGAAGAT
TATGATGAAGAGGAGGAAGCTGATGTTATGGAGGATCTAGGTGCTAGTGCCAAGCCTAAA
CCTTAAAAAGCAGGTAAAAACCCAAAGAAAAAGGAGATTTGGGATGAGTCAAAAGAACCC
CTGCAAGAGGGTGAGGAATTAGTATTTGATAATTCTGCCTATCAAATGCTACATAGAGCC
AAAGTTGAGTGGCCATGCTTATCAATTGATATCATATTGAGAGATAGGATCAATCATCAC
TAGCAGTAGAACAACTGGTTCCCTCAATTTGTGCACAGTATGGACCCCAAAGCGTAGACC
AAAGACAAAAGAGGATAGTTAGCTCATAAACAAGATAAATTCCCATATACTGTATACTTC
TGTGCTGGTTCACAATCACTGAAGAAGAATGAGAACAAAATATACGCAATGAAATGGAGT
GAAATGTGCAAGACTCAGCATGATGATGATGAAGTTAATGAGGATGATGGAAGTGATGAT
GATAACGAGAAAGAGCCACAAATGAGATTTGAATTCGTACCACATAAGGGATGTGTAAAT
AGAATCAGAAGTATGCATGGTACTGGTATTGTAGCCACTTGGAACGATGAGAATGAAGTT
GGAATCTACAATATATCCAATGCTATTGAAGCATTAGACATAGTGCCATCAACAGATAAA
AAGAAGAAGGAATAGAAGAATTTCGGAGGAAGTAAATTGGCTTCATTTAAACATAATGAT
GAGGGGTATGCACTTGACTGGTCACCACTTACCTATGGTAGATTGGCTTCAGGTGGCTGC
AACTCTCAAATCAATCTTTACTTGCCAGCTGATGAAACTTGCTCATCTTTCGTTAAAGAG
ACATAAGTGGGTCTCTAAGGCCATCGTAAATCAGTAGAGGATGTACAATTTTCTCCATCT
TAAGAGCATGTGTTGGCATCTTGCTCAGTAGATTAAACCGTGAAACTCTGGGATTTAAGA
GCCACATCAATGAAATCTCAACTTTCTTTCAGAGCTCACGATTGCGACGTGAATGTTATA
TCATGGAACTCCACTACCAAATTCTTGCTAGCATCAGGAGATGACAAGGGAGAGTTCAGA
ATATGGGATTTGAGAATGCTTAAATTTGATGAGAAAGAACAGAAGAATTTTGACTCAATT
ACCAGAATCAGGTGGCACACTCAAGCCATTACCAGTTTGCAATTCGAGCCTGGTGAAGAA
AGTGTACTGGCTGTTGCTTCAGCTGATAATAAACTCACTCTTTGGGATTTCTCAGTCGAA
GTTGACGAATCTCAATAAAATGCTGAGGATGACATTCCACCTCAGCTGATGTTCTTGCAT
TAAGGTCAATAAAACATGAAGGAGTTGCGTTTCCACCCCTACTATCGTGAAATGATTGTG
ACCACTGCAGAGGACAGCTATAATATATTCAGACCTAACCTTGACCCTGAGGATGATGAT
TTCATTGTAGATGAAAGTGCATCTGACAGTGGCATGTAAAATGACGAAGAATCTAAGGCA
AGTGATTTAACAGCAGCTTCAGTACCAAAGAAGCAGACTCAACCCAGTAACTACTACATT
GGCTCAGAAGACGAGGAGGAAGAAGAGGAACGCATGATAAAGACAGCCAAGAAACTAAAT
AAACAACGCGGCAATAAAAAGGATAAGAAGAACTAGGACGCAAAGAGAAGGAAAATGGAT
GATGAGTGA


>Contig21203.0.g38(protein)
MESTNKANNKKRRNEEASLQGSDDVDMSDVNMDDQQQQQRKIVKVKKREHNPNSMIPEDE
DGDNGVIYSEDEFEEEIIVTRKKGDEEWEDVDSNADDEEDYDEEEEADVMEDLGASAKPK
PQKAGKNPKKKEIWDESKEPLQEGEELVFDNSAYQMLHRAKVEWPCLSIDIILRDRINHH
QQQNNWFPQFVHSMDPKAQTKDKRGQLAHKQDKFPYTVYFCAGSQSLKKNENKIYAMKWS
EMCKTQHDDDEVNEDDGSDDDNEKEPQMRFEFVPHKGCVNRIRSMHGTGIVATWNDENEV
GIYNISNAIEALDIVPSTDKKKKEQKNFGGSKLASFKHNDEGYALDWSPLTYGRLASGGC
NSQINLYLPADETCSSFVKETQVGLQGHRKSVEDVQFSPSQEHVLASCSVDQTVKLWDLR
ATSMKSQLSFRAHDCDVNVISWNSTTKFLLASGDDKGEFRIWDLRMLKFDEKEQKNFDSI
TRIRWHTQAITSLQFEPGEESVLAVASADNKLTLWDFSVEVDESQQNAEDDIPPQLMFLH
QGQQNMKELRFHPYYREMIVTTAEDSYNIFRPNLDPEDDDFIVDESASDSGMQNDEESKA
SDLTAASVPKKQTQPSNYYIGSEDEEEEEERMIKTAKKLNKQRGNKKDKKNQDAKRRKMD
DE