Identifiers and Description

Gene Model Identifier

Contig17166.0.g71

Standard Name

GRSF1

Aliases

Contig17166_0_g71

Description

RNA recognition motif (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00929 ) Exonuclease
  • ( pfam08777 ) RNA binding motif
  • ( pfam06495 ) Fruit fly transformer protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002452002.99851380290819e-19hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17166.0.g71(coding)
ATGGGATAGGCTCCTATATCTAACCTCATTACTCAAAGTACCAATAAAAAGAATGATGAA
TAACAGATGAATTTGATCATTCAATCTTATCCCATTATGATTACTGATTTAAATTTGTTT
GTGCAAGACTAAGATTTCCCAAATATCATATCAATTGACTGGCAAGTTGTAAATGCAAAA
ACTATGGAAGTAAAAAGCAGTGAGAGTTTGATTGTGAAGCCAACAAATATCTCAAAAATC
AAAGCATAAACTCTTCTCAAGACTGGAGTAACAGAATTAATGCTGTAGGAGAAAGGCATC
ACACTTAGTGAGGCATTAGCTAAATTTACTGAGTTTTTATTCAAAGAGCTGATCATGTAA
AACCAATCATTCCAACTCATCACTTTTGGAGATTGGCCATTGTAATATCAACTTCCAATA
GAGGCAACATAAAAGTCTATCAAACTTGGCCCTCACTTCTCTTAATATATTAACTATATG
AAGTTAGTTTTGGAGTTGTACGGAGTTGAAGTTGCAGCTAAACTCACAAGACCAGAGCAA
ATTGTGAATGAATTTAACATCGGAGAAAAGCTTATCGATATACCGATAAAGTCAACATTC
CACTGTGCCCTTATGATTGAGTTCTTCAAGAACAAGATGCTCCCAGATTTACAAACTGTA
ATCAATGAAGAAACACTAGGACAGGATGTTTGTTACAGTCCTACAAACGTGATTGAATAG
AAAGGCAGCAAAGAGAAGGATTTCGCTTCAGAAACAGCTAAGACTTTAGGTCTTGAAGAG
GAGACTAAGCATAGCTCTCTAGATCAAAATCCCTTAATAATGAAGGAAAGAAAGCTATCA
CAGGAGCAGCCTTAATATTAGGGTAGAGATGAAATGAGAAAGAGAAGCCGTAGCAGATCT
TATGAAAGAAATAAAAGGGATAGTGAGTCTCTGAGATAATCAGAATAATAAGGTTCCCAT
CACAGAAATTAAACATCAAACGGTGATCAAAATAGAAATCAGTAACCAGCTTATGTAAAG
ATTTCTAATATCCCTATTGATACTAAGGAATCTGACATTTTCAATTAAATTCCCAAGAGG
ATAACTATCTTTGAAATTGCAATTGGAAGAGACTAATTTGACTAGCATGCTTGCATCTTC
AGAATTGATAGAGATAATTTGGATAATGTCCTTGAACTTGGTATTACACACATAAAGGAT
CAATAAGTACAGGTAAACGAGGGCACTCAAGGGGAATTCAATCATTTGAGACAAAACCGT
AGAGGAGGAAGCAATGAGCATGAAAGAGCTGATCCTCAAATTGACTTCTCTAAATATGAT
TTGAATGACTATCTAGGCTTGAAACTTAGAGGCTTGCCTTTTAGTATTAAGAGAGATGAA
ATCAATTAATTTTTCAGTAATTTCAACTATGTCAGAGATTCTGTGAAATTGGGAAGAACT
GGCGAGGGATTACTCACTGGAGAAGGTGCTATACTCTTCCACTCTGAAGAAGACTCTAAG
AAGGCTTTTCAACAGAGACAAGGCTAGTCTATTGGTCACAGATGGATCGAATTGTATCAA
ATAACAATAGCTGACTACTAAAACTTTGAGGAAATGCAAAAGCAGAGAAGAACAGTGAAG
CTCGGTAAATATATCACAGACTCCAACAGAGAAAGAATCATGAAACTTAGAGGTCTACCC
TTTTAAGTTCAGCCTGATGATATTACTCGCTTCTTCAAGGATTATCAAGTAACCAAAAGT
GATGTGGTAATTGAAGAGATAAATGGAAAGAAAACTGGATTTGGACTGGTTTTCTTCAAG
GATTAGGAAACTGCATAATAAGCTCAAGAAAACATGAACAGAAAGAAAATTGGGAATAGA
TATGTAGAGATTATGGAACCTACTATTACTGATATGATGCCAAATTGA


>Contig17166.0.g71(protein)
MGQAPISNLITQSTNKKNDEQQMNLIIQSYPIMITDLNLFVQDQDFPNIISIDWQVVNAK
TMEVKSSESLIVKPTNISKIKAQTLLKTGVTELMLQEKGITLSEALAKFTEFLFKELIMQ
NQSFQLITFGDWPLQYQLPIEATQKSIKLGPHFSQYINYMKLVLELYGVEVAAKLTRPEQ
IVNEFNIGEKLIDIPIKSTFHCALMIEFFKNKMLPDLQTVINEETLGQDVCYSPTNVIEQ
KGSKEKDFASETAKTLGLEEETKHSSLDQNPLIMKERKLSQEQPQYQGRDEMRKRSRSRS
YERNKRDSESLRQSEQQGSHHRNQTSNGDQNRNQQPAYVKISNIPIDTKESDIFNQIPKR
ITIFEIAIGRDQFDQHACIFRIDRDNLDNVLELGITHIKDQQVQVNEGTQGEFNHLRQNR
RGGSNEHERADPQIDFSKYDLNDYLGLKLRGLPFSIKRDEINQFFSNFNYVRDSVKLGRT
GEGLLTGEGAILFHSEEDSKKAFQQRQGQSIGHRWIELYQITIADYQNFEEMQKQRRTVK
LGKYITDSNRERIMKLRGLPFQVQPDDITRFFKDYQVTKSDVVIEEINGKKTGFGLVFFK
DQETAQQAQENMNRKKIGNRYVEIMEPTITDMMPN