Identifiers and Description

Gene Model Identifier

Contig21267.0.g52

Standard Name

GPN2b

Aliases

Contig21267_0_g52

Description

Conserved hypothetical ATP binding protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR262W3.0012565309061457e-65YOR262W SGDID:S000005788, Chr
XV from 817292-818335, Ge...
T. thermophilaTTHERM_008219109.996907204735647e-62Conserved hypothetical ATP bin
ding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21267.0.g52(coding)
ATGAAGCAAGAAATCAAGTCTAAAGTGAGCGAGATCTGCATAAAGGAAATTGAAGATATC
TCCAGGCATGTAGACTTTCAAGATTAAGAATCAATTGTCAAGTATTTTGATATAAAGGAG
GTTGAGAGGCAATTTGAAAATGGACTTCTAAATGCTGTCTATTCAAGATTGGCTTTAAAA
GGATTATCTGGAATCATAGTTATAGGTGCACCAGGAACAGGAAAGACTACTTTTTGTCAT
GGACTCTAACAGCTTTTGAACTAACTTGACAGGAAACATGCTATTGTAAATTTGGATCCT
GGAAATGACAATATGGAGTATGAGTGCAAGATAGATATTCATGAACTTATTACTCAAGAA
GATGTGATGGAAGAGTATAAGATGGGACCAAATGGAAGTATGATCTATTGTATGGAATTT
TTGGAAACAAACATTGAATGGCTTGAAAAGAAAATTTTGGAGCAATCCCCAACTCGTTAC
TTCATCTTTGACTTGCCAGGATAAGTTGAAATATACAGCAATCACCAAAGCTTATAAAGA
ATCATAGCCCACCTCACAAAGAGTTTGAACTTGAATTTCTCTGCTATACATTTAGTAGAC
TGCACTTATCTCTATGATAAGAACAGATTTTTAGCTTCAATGACTTTGTCGCTTACAGCT
ATTATTGGAATGTAGATGCCGTTCATTAATGCCATTACTAAAATTGACTTGATGAAAAAC
TTTGGAAGACCTGACATGAATCTCTCTTTCTACAATTCAATCTCAGGTCTTGAGTTTCTA
TTCTTTGAAGACTAGGCGAAAGAAAACTAATCCCCTTTTAATGCTAAGTATGGAAAACTC
TCTAGATCTATCTGTGAGGTGATTGAGAACTTTAACTTAGTTGGCTTTTCACTCATCGAT
ATAAACAACAAAATGACGATTTGTAACATCTTGCAGCAACTTGATAAGGGGAATGGCTAC
TTCCTTGACCCTGAGAAAGTTCAAAACCCCAAAGAGATGGAAATTGACTATGAGGCTGTT
GATAGGTACATCGATAGTGAAGTTCTACTTGACATTGAAGAGAAATATTTTGATAATGAT
GGTTAGGAGGAAGACTATTTGTAACAATTCAAGTGA


>Contig21267.0.g52(protein)
MKQEIKSKVSEICIKEIEDISRHVDFQDQESIVKYFDIKEVERQFENGLLNAVYSRLALK
GLSGIIVIGAPGTGKTTFCHGLQQLLNQLDRKHAIVNLDPGNDNMEYECKIDIHELITQE
DVMEEYKMGPNGSMIYCMEFLETNIEWLEKKILEQSPTRYFIFDLPGQVEIYSNHQSLQR
IIAHLTKSLNLNFSAIHLVDCTYLYDKNRFLASMTLSLTAIIGMQMPFINAITKIDLMKN
FGRPDMNLSFYNSISGLEFLFFEDQAKENQSPFNAKYGKLSRSICEVIENFNLVGFSLID
INNKMTICNILQQLDKGNGYFLDPEKVQNPKEMEIDYEAVDRYIDSEVLLDIEEKYFDND
GQEEDYLQQFK