Identifiers and Description

Gene Model Identifier

Contig18293.0.g107

Standard Name

GPN2a

Aliases

Contig18293_0_g107

Description

Conserved hypothetical ATP binding protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004418101.0003926095686843e-81Conserved hypothetical ATP bin
ding protein
SGDYLR243W9.995417076252815e-72YLR243W SGDID:S000004233, Chr
XII from 624203-625021, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18293.0.g107(coding)
ATGGCAACAGGCTTTGGATGTATGGTCGTAGGATCAGCAGGAAGTGGAAAATCAACATTT
TGCTAAGTATTGCAAGAGTCAGGAGAGACCCACAAGAGAGTTTATAAAGTTTGCAATTTA
GACCCAGCTGCAGAAGTGTTCAAGTATAAATGCGATATTGACATAAGAGATCTGATTTCA
TTGGATGATGTTCAAGAAGAACTGAAGTATGGTCCTAATGGAGGGTTGATTTATTGTATG
GAGTACTTAATTGAGCACATAGACTGGCTTATGGAGGAGTTAAACGAGTTTGCAGAAGAC
TCATTTATACTTTTCGATTGCCCAGGCTAAATTGAACTGTACTCACATCTTGATGTCATG
ACGAGGTTGACCAGGGAGCTATCAAAGACTGGTTTCTTTATATGTGCTGTGTACTGTGCT
GATGGTACTTTCATCAATGAACCTACAAAGTACATTTCAGCTTGTTTCACATCATTGTCT
ACAATGACTCAACTGAGCATCCCACATATTAACATTCTGACTAAATGCGATAAAATGGAC
CCAGAATTAATCGAGAAAGTGACTAACATGCCAACTATCGAAATCTTGAACTCAATAAAT
TCCAATTTACCCCCTAAGTTCTATGAATTGAACACTCGCATAGTTGAAGTCATCGACAAC
TTCAACATGGTTTAGTATGTACCTCTGAACATTCAAGATGAAGAATCTATTGATACCATC
ATGCAGCAGATTGATTCAGTGGTCTAGTATGATGAATTCAGGCTTCCTAAGGAGAGCTTG
CTTCCAAATGACGATGGCAATGAAGACGACTAGGAAGATGGTGATGGCGGAGATATGGAA
TAGTATTGA


>Contig18293.0.g107(protein)
MATGFGCMVVGSAGSGKSTFCQVLQESGETHKRVYKVCNLDPAAEVFKYKCDIDIRDLIS
LDDVQEELKYGPNGGLIYCMEYLIEHIDWLMEELNEFAEDSFILFDCPGQIELYSHLDVM
TRLTRELSKTGFFICAVYCADGTFINEPTKYISACFTSLSTMTQLSIPHINILTKCDKMD
PELIEKVTNMPTIEILNSINSNLPPKFYELNTRIVEVIDNFNMVQYVPLNIQDEESIDTI
MQQIDSVVQYDEFRLPKESLLPNDDGNEDDQEDGDGGDMEQY