Identifiers and Description

Gene Model Identifier

Contig14909.0.0.g16

Standard Name

GPATCH1a

Aliases

Contig14909_0_0_g16

Description

Protein of unknown function (DUF1604)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07713 ) Protein of unknown function (DUF1604)
  • ( pfam06698 ) Protein of unknown function (DUF1192)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002453500.000000000000008995967261938872hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14909.0.0.g16(coding)
ATGCAGAGAAGAATCTAAGGTTTAGACAAGAAACCTTGGGAGCAAGAGGGTAGAGACGAT
CAGGGCAGAAAGCATTTCTATGGAGCTTTCACTGGTGCTCTGAAAGAGTTCTCTGTAGGC
TATAAAGGCACAGTTGGCTCCAAAGAAGGATTTCAACCGAAATAGTTTGTGAGTTCAAGA
AGCGAGAAGAAAGGAACTTAATTTCAGCAGCAGTCTATCTTCGAATTCATGGATGAAGAT
GACATGGGAGAACATACAGCAGGCTAGACTTTCCAAGCAACACAACAATACTCCGATACC
CTAAATTCCCAGTAAAAAGATCTCTTGAAGAGTGGAATCTCGGGCGACATCTAGAATAAC
ACTTTCATTCCTGATGAGTTAGTGGTGACAACCAACAACTCCAAGGGATACCAGTTGATG
AGGGCGATGGGCTTCAAAGACAGAGGCAGCAGCAAATATTGCTTCAATCACTACGAAGAC
TCACCAGAGGAGAGTGAGGATGACATGTAATAGTAATAGGATGCTTTTGATCATTTGGGG
TTCATGATTCCCTAGAAGAGATAGAGATAGAAAGAGCAAAAGGGGAAGAAGTACTATGAT
GGACCCATTGGCTTCAAGAATAACCTATTTGGCATTGGGTTTGTACCCACCAGAAGTGAT
TTAGATGAGATAGATCCAGACGCTGCTGAGCAAAGACAGAAGAAGCAGCAAAACAGAATA
AAAATGTCAGAATTTGACTATGCAGGAATTGAAGTGGATGAGGATGATGACAGTGTATAG
TAAATTTCGAATGTCTATGACACACAGAAAGACAAGTCTAAAATGTACAAGGATTCAATT
GAACTTGATGATGAGGAGTTAGATTAATATGGTATGAGTAATGTAAACAGAAAAGGACTT
ATTTAAAAATCCTCAGTTGAAAATCAAAAGCCTAATTAGTTCATAATTGGAGGCACCTTA
CAAGTAAAAAAGATAGGAGCAAAACCAGTTCAAGTACCAGCAGGTTACAATCCATTTAAG
GACTTGGATAGTTAAACTACTACAGAAATAGCTAATTAGTAAAGCAAAAAGAGAAACCTG
ATAGATGAAATAATTATAGATCATAGCAAGAAATTTATCAGTAAGCAAAGCAATAACCTA
GATGCAAATAAGCGAGCTGAGATACTTGGCGAAACTGAGGGGATTCAATAAACCAATGCA
TAAATATACAATAATAGATTTCAAGCATCCACCTAAGATTAACAACAAATTTAACATCAA
GCCTTGAAATAGTAATAATCAAGCAACTTACCTCAATAACCTTACTATGAATGCTTAAAC
TTTCTCATAGACATACCCTTTAAAACAACAGATTCAAAGAGGTATCTTCGGTTTAAAGCC
TATTGTCTGGATATAGATGGTTAACTCGTGACATTTGACGTGCCAAACAACATGATGACT
GGGTCTTAATTGAAATTAGAAAGACAAGAATTTGATAAACTAATAAAACTCAATAAAATG
ATGAAGCAGCAGAAGCAAGAAGCACTGGAGAGTGGTAGAATCGATAAAGATCAAGCTAAG
TATTAGGCTGGAGTATACACAAGTGAAATGAAAAACAGATCTTAATAAGACATCACCAAG
AGGATAGAGCAACTTGAAAAAGAAATCAACAAACGTGAAGAATAGAATTGGTAGCCTGCA
CCTCTGCTACTCACTAGATTTGGGCTTTTAGATCCACACGAATCTAAAAAGATTAAGCCG
CCTATGTTCTTCAAGAATTTGAGATAAGAGTAGAAGTAGCAAGTCACTTTTGACAGTAAG
GGAGAGACTTTGCTTAACATCCCTGGTAGCTCGATGGCTAACGAATAACCCAATATAGAT
GGCGACGAGTACTTTAGAAATATCTAAGAATAGTTTGGGATGAATTAAGGCATGGAAGTT
GTCAAAGATAAAAATGATGATTTATCTCCTCGCAAATTGCTATTGTTGACAAGAGTTTGA


>Contig14909.0.0.g16(protein)
MQRRIQGLDKKPWEQEGRDDQGRKHFYGAFTGALKEFSVGYKGTVGSKEGFQPKQFVSSR
SEKKGTQFQQQSIFEFMDEDDMGEHTAGQTFQATQQYSDTLNSQQKDLLKSGISGDIQNN
TFIPDELVVTTNNSKGYQLMRAMGFKDRGSSKYCFNHYEDSPEESEDDMQQQQDAFDHLG
FMIPQKRQRQKEQKGKKYYDGPIGFKNNLFGIGFVPTRSDLDEIDPDAAEQRQKKQQNRI
KMSEFDYAGIEVDEDDDSVQQISNVYDTQKDKSKMYKDSIELDDEELDQYGMSNVNRKGL
IQKSSVENQKPNQFIIGGTLQVKKIGAKPVQVPAGYNPFKDLDSQTTTEIANQQSKKRNL
IDEIIIDHSKKFISKQSNNLDANKRAEILGETEGIQQTNAQIYNNRFQASTQDQQQIQHQ
ALKQQQSSNLPQQPYYECLNFLIDIPFKTTDSKRYLRFKAYCLDIDGQLVTFDVPNNMMT
GSQLKLERQEFDKLIKLNKMMKQQKQEALESGRIDKDQAKYQAGVYTSEMKNRSQQDITK
RIEQLEKEINKREEQNWQPAPLLLTRFGLLDPHESKKIKPPMFFKNLRQEQKQQVTFDSK
GETLLNIPGSSMANEQPNIDGDEYFRNIQEQFGMNQGMEVVKDKNDDLSPRKLLLLTRV