Identifiers and Description

Gene Model Identifier

Contig18790.0.g37

Standard Name

GPATCH11

Aliases

Contig18790_0_g37

Description

G-patch domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01585 ) G-patch domain
  • ( pfam12656 ) DExH-box splicing factor binding site
  • ( pfam13821 ) Domain of unknown function (DUF4187)
  • ( pfam10669 ) Protein gp23 (Bacteriophage A118)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004675400.000019995566179747357G-patch domain containing prot
ein
SGDYLR271W0.00020003864201578029YLR271W SGDID:S000004261, Chr
XII from 682737-683561, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18790.0.g37(coding)
ATGATTAAAATCAAGAAATCGAAAGCCAATTTTTCAAACAAAAATAAAAAGGATAAAGAA
TCTGAGAAAGAGGAGGATGATTTTATGAGTGATAAGTTCTTGTTAAATGCTGAATTGATA
GATTAAAATATTAGAAAGGATAAAATGTAGAAGTAGAGGTTTGACACTAAAATTAAGAAT
GCAGATAAACTTAAGCATGTAGTACCTGTTGATAATTCTGAGAAGAGGTTAGACATCTTG
AATGAAAGTAACGAACCAGAAATTACCAGACACAATATAAAGCATTAAATGTTTCAAAAA
TTACAAGAAGGTCTATAAACCAAAATATCAAAAGAAAATAAGGGTTTCTAACTTCTCATG
AAACTTGGCTTTAAAGAAGGGCAAGGGTTAGGGAAGAAAGAATCAGGAATCAAAAACCCT
TTGGAGTTAGAGATGAAAAACAATAAAATTGGGATTGGCATTGATCTTGTTAAAAAGGAG
AAAGTTATGCTTCTACAGAAGTATTCTGAAGAAATGGCTAGTAGCTTTGTTAATGCCAAG
AAATTTGAGTTTTTAGTCAAGAAATTGAAGAGAAAACTTAAGGATATTTTGACATTTTTG
GAGAGACAAGAGCAACTAGGTCCAGAAGTTGATTTTTGCAATTTGATCAACTATCTAATC
CAAGATGAAGTTTGTTAATAGAAATAATTATCATATAAATAAAGAACTGGCAGTAAAAGG
TAACATGATAGAGAGCAATATCTGAGTGAAGATGAAAATTAATCTACTACCTTGCACGAT
TTATTGGTGGTTCTATCATAAATGAGAGTGTATTTGAGAGAAAACTATAGCTATTGTGTT
AAATGCAAAGTTGGAGATATAGATAAATATCCCTGTAAGCATTGCTTATGA


>Contig18790.0.g37(protein)
MIKIKKSKANFSNKNKKDKESEKEEDDFMSDKFLLNAELIDQNIRKDKMQKQRFDTKIKN
ADKLKHVVPVDNSEKRLDILNESNEPEITRHNIKHQMFQKLQEGLQTKISKENKGFQLLM
KLGFKEGQGLGKKESGIKNPLELEMKNNKIGIGIDLVKKEKVMLLQKYSEEMASSFVNAK
KFEFLVKKLKRKLKDILTFLERQEQLGPEVDFCNLINYLIQDEVCQQKQLSYKQRTGSKR
QHDREQYLSEDENQSTTLHDLLVVLSQMRVYLRENYSYCVKCKVGDIDKYPCKHCL