Identifiers and Description

Gene Model Identifier

Contig11968.0.g33

Standard Name

GNL2

Aliases

Contig11968_0_g33

Description

NGP1NT (NUC091) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010287705.002214508058008e-169conserved hypothetical protein
SGDYNR053C3.9988573992424687e-147NOG2 SGDID:S000005336, Chr XIV
from 721770-721120,72311...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11968.0.g33(coding)
ATGGTAAAGAGAAACAAGTCAGGTAAGACTGAGCAGTTTAGTAAAGTCAACCGTAGTAAG
AACTTGAAGATGAAGTCAAACACTGGAACTTCATTCAAGCACACTGGTACTGCTTCCACA
AACCCATACAGACCAGATCCCTCTGGAGGTAAACCTGGAAGTAGATTCAGAACTAGACAA
ACCATCAACAGATTGAATATGTACAACTCAAAGCCCGACAAAGAAAAAATGAAGGAGAGA
CCCACAGATCCACATGCTGGTAGAATTCAACCAGATCGCAGATGGTTTGGTAACGTCAGA
ACAGTCGACCAAAAAGAATTGGACAAGTATAGAAAGTCACTCGAAGACAAGCAAGTCAAG
ACAGGTACTGGATACTCAGTTTTGTTGAAGGGAAAGAAATTACCACTCAGTTTAGTTAAA
GACACTTATGATAAGACTCTTAGCAAAGGAGAGAGATTGTTGCAGATTGAAAAGTATGAA
GACACATTTGGACCAAAGATGAAGAGAAAGAGACCAAATGTAGGAATAACAGATTTAGAA
GCTATGGTTAAGACTATTCAAGAGAAATCTGAAGGCTATGATGCTGCAAAAGACTTAGAT
CTCCACAAGAATGACATGATAGAGACAAGAGACGGTCACAGACACAAAGTTTTCGATAAG
GGTATGAGTAAGAGAATTTGGGAGGAGCTCTATAAAGTTATTGATAGTTCAGACGTGCTC
ATTCACGTTCTCGATGCCAGAAATCCCAATGGAACTAGATCAAAGTTCTTGGAGGACTAT
TTCAAGAAGAACTGCCCAAGCAAGCATTTAGTTTTCGTACTTAACAAGTGCGATCTCATT
CCTACATCTGTCACACAGAAGTGGGTCAGATATTTGTCTAAATTCCACCCCACACTTGCC
TTCCAAGCCTCAGTTAATAATCCATTTGGAAAAGGCAGTTTGATTCAATTGCTCAAGTAG
TTCGATTTAATGCACAAAGACAAGAAAAATATCAGTGTTGGTTTCATTGGTTATCCAAAT
GTAGGTAAATCCTCAGTCATTAACACTTTGAAAAAGAAGGCAGTGTGTAAGGTAGCACCA
ATTCCAGGTGAAACTAAAGTTTGGCAATACATTTCAATGACTAAACGTATATATCTGATC
GATTGCCCAGGTATCGTTTATGACCCAGGTGAATCACTTACTGACAAAGTTTTGAAGGCC
GTCGTCAGAGCCGAGAAAGTTCCAGATCCAGAAATTTACATCGATGCTATTCTTGAAAAA
ACTGAGCACAAACACATCGCAGACGTTTATGGTGTAAATTCTTGGACAGATGCAGAGGAT
TTCATAAACTAATTGGCTGTGAAGACAGGTAAATTAGTGAAGGGTGGAGAGCCAGACATC
AACAACGTCTGCAAGTCAATCATTATGGACTGGCAGAGAGGTAACATCCCTTACTTTGAA
CTACCACCAAAGAATGAAGAGGAGCAAGATAAAGAGGATCACGGAGATGACGAGGAAGAT
AATTAACAAGTAGAAGAGACCAAATTGGAAGAGGAGGATGAAGAAGAGGATAACGAAGAA
GACGACTCTTGA


>Contig11968.0.g33(protein)
MVKRNKSGKTEQFSKVNRSKNLKMKSNTGTSFKHTGTASTNPYRPDPSGGKPGSRFRTRQ
TINRLNMYNSKPDKEKMKERPTDPHAGRIQPDRRWFGNVRTVDQKELDKYRKSLEDKQVK
TGTGYSVLLKGKKLPLSLVKDTYDKTLSKGERLLQIEKYEDTFGPKMKRKRPNVGITDLE
AMVKTIQEKSEGYDAAKDLDLHKNDMIETRDGHRHKVFDKGMSKRIWEELYKVIDSSDVL
IHVLDARNPNGTRSKFLEDYFKKNCPSKHLVFVLNKCDLIPTSVTQKWVRYLSKFHPTLA
FQASVNNPFGKGSLIQLLKQFDLMHKDKKNISVGFIGYPNVGKSSVINTLKKKAVCKVAP
IPGETKVWQYISMTKRIYLIDCPGIVYDPGESLTDKVLKAVVRAEKVPDPEIYIDAILEK
TEHKHIADVYGVNSWTDAEDFINQLAVKTGKLVKGGEPDINNVCKSIIMDWQRGNIPYFE
LPPKNEEEQDKEDHGDDEEDNQQVEETKLEEEDEEEDNEEDDS