Identifiers and Description

Gene Model Identifier

Contig1080.1.g59

Standard Name

GLD4b

Aliases

Contig1080_1_g59

Description

Cid1 family poly A polymerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03828 ) Cid1 family poly A polymerase
  • ( pfam01909 ) Nucleotidyltransferase domain
  • ( pfam14091 ) Domain of unknown function (DUF4269)
  • ( pfam04424 ) Protein of unknown function (DUF544)
  • ( pfam10620 ) Phosphoribosyl-dephospho-CoA transferase MdcG

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005694205.997992534675281e-52Chitinase class I family prote
in
SGDYNL299W1.9990449803848145e-49TRF5 SGDID:S000005243, Chr XIV
from 66517-68445, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1080.1.g59(coding)
ATGACAAAGAAGAACTTGAAAATAGACTGGCAGCTAAGTATGACAGAGACCTCTACCCAT
GACTTCGTGAACTTTGTTACACCCAGCAAAGAGGACAAGGAAATCAGAAACAAGGTAGCA
ACTTCAATTGAAGAGGTGATCAAAGGGGTATTCCCTGATTGCCATGTATTTGTGTTTGGA
TCATGTGCGACTGGCTTAAACTTGCCTAATTCTGACATTGATCTAATTGTTTACCAACCA
GATGTTAGTGAATCAAGAATGATAACTAAAGTTGCAGATGCTATTGTGAGATAGAAGAAG
TGTAAGACTATTGATGTACTCAAGAATACAAAAGTGCCTTTAATCAAAATAACAGACAGT
GAATTTGGGGTAAATGTTGACATTTCATTCAATAGAACGAATGGAGTTTACTGCGTGAAA
CTTGTCAAACAGCTTTTGTAGATGTTTCCTGAGCTCAAACCATTAATGATGGTTCTCAAA
TGTTTCCTAAAGTCGAGGCAGTTAAACGAACCATACTCTGGAGGTGTCGGTTCATTCTTA
CTTACTATGATGGTTACCTCATTTCTGTAAAGATAGTATAAATTGGGAAACACTAACAAC
TTGGACTTAGGGAAGTAACTTTTAGATTTCTTTAAGCTTTATGGAACAGAGTTTAACTAT
CAACATGTGGGAATATCAATCAGAGATGGTGGATTCTACTATCAAAAGTATAAGAGAGGT
TGGGAAGGTCGTGATGAGAGATCTTATGAGAGATTATCAGTAGAGAACCCATAAGACCCT
GAAGTTGATATTGGCGGTAGTGCTTTTAACATTAAGAGAGTCTAACGTGCATTCCAGCAT
GCATATGACACACTTATTTATAATAATAGCAACAGTGTTAGCATTCTTAAGTTAATTATC
ACTAGTGATCCAAGCGAGCTTAACTCTGGGTGGAAAAAGCAACAAAAATGA


>Contig1080.1.g59(protein)
MTKKNLKIDWQLSMTETSTHDFVNFVTPSKEDKEIRNKVATSIEEVIKGVFPDCHVFVFG
SCATGLNLPNSDIDLIVYQPDVSESRMITKVADAIVRQKKCKTIDVLKNTKVPLIKITDS
EFGVNVDISFNRTNGVYCVKLVKQLLQMFPELKPLMMVLKCFLKSRQLNEPYSGGVGSFL
LTMMVTSFLQRQYKLGNTNNLDLGKQLLDFFKLYGTEFNYQHVGISIRDGGFYYQKYKRG
WEGRDERSYERLSVENPQDPEVDIGGSAFNIKRVQRAFQHAYDTLIYNNSNSVSILKLII
TSDPSELNSGWKKQQK