Identifiers and Description

Gene Model Identifier

Contig12798.0.g75

Standard Name

GLD4a

Aliases

Contig12798_0_g75

Description

Cid1 family poly A polymerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03828 ) Cid1 family poly A polymerase
  • ( pfam01909 ) Nucleotidyltransferase domain
  • ( pfam14091 ) Domain of unknown function (DUF4269)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL299W2.9992141389250636e-57TRF5 SGDID:S000005243, Chr XIV
from 66517-68445, Genome...
T. thermophilaTTHERM_005694206.00092892288903e-46Chitinase class I family prote
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12798.0.g75(coding)
ATGAACTAGAAGAAGAGGGTTGCTAAGTAATAACACAAAGAATATTTGAAATAGTTAACT
GAATAGTAGAAAGAGGGGAGTCAGAAGAATAAAGTTTCTGGAGAGATTGATTTCTTGGCA
TTCTCAAGTGTAAAGAGCAATTTTGATATTAAAGCCAACGTGATAGGCAAAGAACAAGGC
ACATAAGGAGCTTAATCTAACACAATCACAGATCCAAAAGATGACCTAGAATTAAGAATA
GCATAAAAATACAACAAAGACGAAGAATACCCTTGGTTAACTAACGACACTATGCGTATT
CGTGATGCTTAAATTTTCCTGCACAATGAAATCCTTGATTTCGTGAAATACATTGGAACA
ACCACAGAAGACCAGTAAGCCAGAAGGAAAGTAGTGTCTCGCATACATAAAATAGTGAAA
GAGTGCTTCTCACAAGCTAAAGTCATGATTTTTGGATCTTGTGCGACTGGCTTAGATCTC
CCAAATTCAGATGTGGATTTGTTAGTTTACTACCCTGATTAGAGAGAACAAAATATGATT
AACAGATTGGCTGGATCTTTAATGAAATCAGGAATTTGCAAATCAATTGAAGCTATAAAG
CACGCCAAAGTGCCAATTATCAAGTTACAAGATAAAGAGACTTCTTGCAATATTGATATA
AGTTTCAATAGAACAAACGGCATATACTGTGTGAAACTTGTCAAAACTTTAATGATAAAA
TACCCAGAACTCAGGCCATTAATGATAGTGCTAAAAGCTTTCCTGAAATGCAGAGGATTG
AATGAAACTTACTCAGGAGGCATCTCTTCATTTTTGCTTACTATGTTAGCTACTAGTTAC
CTATAGATGGCATACAAGTCAGGAAAAACTGATAAAATGGATCTTGGCAAGCATTTGATT
GATTTCTTTGAGCTTTATGGAACTAAATTCAATTATGAGTAGATTGGCATATCAATCAGA
TAGGATGGATTTTACTTTTAGAAAGTGAAAAGGGGTTGGTAATAATACGATGAAAAAAAT
AAATCAAGGCTTTGTGTTGAAAATCCCCAAGACCCCACAATCGATATTGGCTTTAATGCT
TACAACATCAAAAGAATTCAGAGGGCGTTCTAGCATGCTTATGACACACTAATATATAAC
AGTAGTAACACGGTTAGCATCCTCAAGCTTTTGATAACTTCAAACATAAACGAATTCAGG
TTAATTTAATGA


>Contig12798.0.g75(protein)
MNQKKRVAKQQHKEYLKQLTEQQKEGSQKNKVSGEIDFLAFSSVKSNFDIKANVIGKEQG
TQGAQSNTITDPKDDLELRIAQKYNKDEEYPWLTNDTMRIRDAQIFLHNEILDFVKYIGT
TTEDQQARRKVVSRIHKIVKECFSQAKVMIFGSCATGLDLPNSDVDLLVYYPDQREQNMI
NRLAGSLMKSGICKSIEAIKHAKVPIIKLQDKETSCNIDISFNRTNGIYCVKLVKTLMIK
YPELRPLMIVLKAFLKCRGLNETYSGGISSFLLTMLATSYLQMAYKSGKTDKMDLGKHLI
DFFELYGTKFNYEQIGISIRQDGFYFQKVKRGWQQYDEKNKSRLCVENPQDPTIDIGFNA
YNIKRIQRAFQHAYDTLIYNSSNTVSILKLLITSNINEFRLIQ