Identifiers and Description

Gene Model Identifier

Contig17966.0.g102

Standard Name

GLD2c

Aliases

Contig17966_0_g102

Description

Nucleotidyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010503600.000030009396760408108Nucleotidyltransferase domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17966.0.g102(coding)
ATGTAAAATCTTGAACATATCTCATAATTTCTTGGTGTCCTGGAATCTAATAAAGATCTC
TAAAGAGTAATAAACATTATTGATCCTAATCTTAGAGATAAGATACTTGGCTGTGCTGGT
AGAGCCAACATTTTGGTAAACTTTTTGATTCTTGAAAATTATGAGGAAAACAGTGAAATG
ATCCACAGACTTAAGAACTTCTAAGATCATCTGCCTAATTCAGAACTTTCTGAAGTTATC
GCCTTATATGAGTCCTTCTTTATACTACTACAAACTGAAATATTCTCCTTGCCAAAAACA
TTTAAGACTCAAAAAAATAAAATTAGAGGAGATATATTAATTACTCTTTAAAACCTTGAT
AGGAGTATCTTATCTAAGTTTATGGATTTTTGTGAAAATTATACCACATTAATCTTAAAA
GTAGCGAAATATCTTCATGAAAATGTCTTTAATTACTCAATGAAAAGAAAATTGGTAATA
GCTCTAACATTAAAGAATATAAGCTTAGAAGCAATTGATGCCAATGAACCTTCTCCACCT
TAACAAAACGCTGTTCATGTTCAACCTTAACTAGTTTTATCATAATAAATTGACAACAAA
ATTTCAAACTTAAATTAAGTTAACTATCACCATTCAGGCAATATGAACTAATAAAATATA
TAATAGTAGTAGAGATATAATGATAATAAGCCAAACTTAAACTAAAATATCGATAATTAT
AGCATGTGTGAAGAAAATGAGCAAATCTTTTACAACGGTGGCTATAACTAATCTTAAAAT
TTTATTGATAAAGCAGGCTACGATGAGTAAAATTCTAGTTATGCGAATTATGAAGAGAGG
AAAACTCCAAAGAAGCAGCAGGAATATTATAGGGAAAGTCACTAATTAAACTAGCTGTCG
TAAGGATATTAGGGTAGTTAGTTTATGCTTTCCAATTAAAGTCACAACAACTAACAGAAC
TTAGATAATCAATTATAGAATTAAGCTAACTACTAAAATCAAAGAAGCACAGAATATGAA
TAAAATGAGCTCTAGCAATAACTTAAGGGTATGCTAAATGAAAGTATGACTGGAAACTTC
AACAGTAATCCTCAAAGTAAAAATTAAGTTTCTCAAGAATAAAAATAAGCGAGCAATAAC
AATATCAAATTGCGATAGTCTTCTGATTAATAAATATTATCAGACTTGAAAGAGTTTGCT
CCGATAGAAACAAAGACTTTAAGCTCAAGAAGTAAAGAAATTAATGACAAGTTTTTCGAT
CAAGGGGAAAAAGTGAGCAATGAAAAATAGTGGAAAACTTATTGCTAAAAAATGGATAAA
CTCTTACTATAGAAAGCAGAATCTCTAATGATTACAGACTAAGATAAAAACTAAATTTCA
AAATCATTCTAAAAGTTACAAAACTTAATATTCTAGTTTAAGAATGAAATTACTGAGTTA
AGAGATAAGAATGTTGCTGTATTTTTATATGGATCAAGTGTTAATGGGTTGAGCCTGAGA
GGTGAGAGCGATATGGATATTACAATATTAGTGAATGCTTTATATTGCAATCACAAGATG
ATACTAGAGTCATTACAAAAAGCTATATTTGTATAGGATTGCTATGAAAACTGCGAAATA
ATTGAGTTCTCAAGTGGAATAATGCTCAAGTTTTATGATACTCAATACAAGCTATAAGTA
GAGATACAAATCAACAAGTTATTAGAATTAAAAAATTCATAACTGATTTAAGCTTATTCA
AAACTAGATAAAAGATTTTTGAAATTAGCTGTTCTTTTGAAATATTGGAATAGGAAGCAC
TTTCCAGATGCCAAGTGCAGACTTAATTCATATTCTATTGTGTTAATGCTGCTCGCAATG
TTCTAAGATTCGAACATACTTCCTAAGTTGCAATAATTAAACTCAGAAAAAAATTGTGAA
GTTATCAGTGTGAGCAAATATAATCCTAAGAGTCAGTTCTAAGCTAAAAATCCAAACTCA
TTTGGCTAATCATAAAACAGAGGAAATTTAGAGTTTTTCACAGATATCGGATTTGAAAAA
GATTAGAATATCATAGAATAATTCATGATTTATAAAGAAAAGGAAGTTAAATTGTCAAAA
TTAACTAATTAGCAATTCTCACTTATTGAGCTTTTGCTTAAGTTTTTCGAGAAATATTAA
ATTAACCAGCAAAACCCTTCAACCATGTTTATCTCTGTTGGATGTCAAAATTCAACCCAG
ACATATTTAACGAAGAATTAATATATGCAAGAGATTTTGTAATAATTTATCAATGAACAA
GATAATTAGTTACTTAATAATTATCTCTAAACAACTTTATTGAGGGATCTTGACCAATAT
ACCTACGTGATAGTGGACCCCTTTGATAAAACTTACAATCCTGCTAAAGCATTAAAGAAA
AACTATTAGGTAAATATAAAATTCTAAAGTATGATGAAGTCAACATCCAAGAATTTACTT
GAATTAGAGAGTATAAAAGATTTCTGA


>Contig17966.0.g102(protein)
MQNLEHISQFLGVLESNKDLQRVINIIDPNLRDKILGCAGRANILVNFLILENYEENSEM
IHRLKNFQDHLPNSELSEVIALYESFFILLQTEIFSLPKTFKTQKNKIRGDILITLQNLD
RSILSKFMDFCENYTTLILKVAKYLHENVFNYSMKRKLVIALTLKNISLEAIDANEPSPP
QQNAVHVQPQLVLSQQIDNKISNLNQVNYHHSGNMNQQNIQQQQRYNDNKPNLNQNIDNY
SMCEENEQIFYNGGYNQSQNFIDKAGYDEQNSSYANYEERKTPKKQQEYYRESHQLNQLS
QGYQGSQFMLSNQSHNNQQNLDNQLQNQANYQNQRSTEYEQNELQQQLKGMLNESMTGNF
NSNPQSKNQVSQEQKQASNNNIKLRQSSDQQILSDLKEFAPIETKTLSSRSKEINDKFFD
QGEKVSNEKQWKTYCQKMDKLLLQKAESLMITDQDKNQISKSFQKLQNLIFQFKNEITEL
RDKNVAVFLYGSSVNGLSLRGESDMDITILVNALYCNHKMILESLQKAIFVQDCYENCEI
IEFSSGIMLKFYDTQYKLQVEIQINKLLELKNSQLIQAYSKLDKRFLKLAVLLKYWNRKH
FPDAKCRLNSYSIVLMLLAMFQDSNILPKLQQLNSEKNCEVISVSKYNPKSQFQAKNPNS
FGQSQNRGNLEFFTDIGFEKDQNIIEQFMIYKEKEVKLSKLTNQQFSLIELLLKFFEKYQ
INQQNPSTMFISVGCQNSTQTYLTKNQYMQEILQQFINEQDNQLLNNYLQTTLLRDLDQY
TYVIVDPFDKTYNPAKALKKNYQVNIKFQSMMKSTSKNLLELESIKDF