Identifiers and Description

Gene Model Identifier

Contig10883.0.g40

Standard Name

GLD2b

Aliases

Contig10883_0_g40

Description

Nucleotidyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01909 ) Nucleotidyltransferase domain
  • ( pfam03828 ) Cid1 family poly A polymerase
  • ( pfam09669 ) Phage regulatory protein Rha (Phage pRha)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000940000.000000000004997916451710233hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10883.0.g40(coding)
ATGTCAACTTTTAACGATTTCACGAAGGACAGTCATGAAGTTTTAGGTTTGGATATCCCA
CAGATCCAATCAAAAACACATGACTTGCAAATCTTGAAGAGGTTTAAAGCCTTTAGTGAG
CAATTCACTGAACTAATAACTGAAGCTTATGAGACTATTGAATCCTCAGCTGCATCATAA
ACCAATAAACTACACGGAGCTAAAATTGAAAAGGTATTTTAGATGCTTCTATCAGTAGTC
TAATGCCAAAGTTTCGAGACAATTTACTAATAAGTCCCTGATTTTTAAAATTATTAGGAT
AAGGCCATTTAGTAGTGCTACAAATATTACTTTTCATCAAAACAAACTTAGGCAGTAAAA
GATCAAATTAAGTATGGGAAAAATAGCTATTAATAATAATAAAACAAATCAGAAGTCATT
CGGGAAGTAGTCTAAAATAACATTGATTTCATGCTCGATTATTCAAAAAAATAATAATAA
TAATAAAAAATGGATTAAGGAAATTAAAACCCAAGGAAAAATAATTTGGTCATTGACAAG
GAAAATTTGAGGCGTATTTATGACAAATATAAGTAAAACAGATTGACAGATCACTGGGAA
TCCAAAGTCAAGAACATAGATGAAATGATTGATAATGTCTTTCAAAGTAACACGACAGTA
GAGGAGGACGTTCTTAATATTGATGAAGTTTTCTAAGTAGTGAAATAAATAGTGCAAAGG
GGTATGCAACGCGAACACCCTGGGTGCCATTTACTTATGTACGGATCTTGTGTCAATGGA
CTAGCTCTGAAAGGGAACTCAGATTTAGACATGACATTAATCATAGACAACCTTGAAATT
GATCACTAAAACGTGCTAAGAAAAATTGAGTCACTGCTGAGAAGTAAAAACTCTAATTAT
GGAAATAGATTTCAAAATCTTCACATTAAAATGATTAAGAGTGGTGCCCACATTACTTTT
TTAGATAAAGAAACCAATATAGATTTGGAAATATCGATCAATAAAATCTTGGAAGTCTAC
AATTCATAACTACTGTATACTTATGCTCTGGCCGATGCTAGATTTCACAAATTAGTGGTT
TTATTGAAAAAATGGAATAAAAATAACTTCCCAGATGCTTCCAGACGCATAAATAGCTAT
AGCATAGTCTTGATGCTTCTAGCCGTCATGTAGGGTGAAAAGATAATGCCTAAATTGCAA
ATAATTAATAGAGAAGAAGGTTAACAAAGAATGATTCGATATTAGAAATATGTGCAGAAT
CCAAATAACTTCAATCTCATCAACACAATATATGAAGCTGATGTATATTTTGAATCAGAT
TTGGATTAAATAGGCAAAAGTTTCAAACCTGCTATATATTTACCATCCAAAAAACTTCAC
ACTCCAGCCGAAATCCTGATCCTCTTCTTCAGGACTTACATATTCTTATTCAACTCTACT
AATCATGGAATAGATGTGACCAACAACGTTTAATTCAAGGATAAATCATTAATAAAATTA
GAAATACTTAAGTAATTTTAGGAGAGTGACACTTATATACAAGCTAATGTACTAAATGAT
ATTAAAAATTTCACATTTATGATTGTGGATCCTTTCGATAAAAGCTACAACCCGGCAAAA
GCTTCAAGAATTGGATGTGATCTAGAGAAGAACTTTTTCAAAAAATTAAACGAAACTTTT
GATGATTTAATGAATGATTAGAAATTTGATTAATTTATTAAGTGGAGATGA


>Contig10883.0.g40(protein)
MSTFNDFTKDSHEVLGLDIPQIQSKTHDLQILKRFKAFSEQFTELITEAYETIESSAASQ
TNKLHGAKIEKVFQMLLSVVQCQSFETIYQQVPDFQNYQDKAIQQCYKYYFSSKQTQAVK
DQIKYGKNSYQQQQNKSEVIREVVQNNIDFMLDYSKKQQQQQKMDQGNQNPRKNNLVIDK
ENLRRIYDKYKQNRLTDHWESKVKNIDEMIDNVFQSNTTVEEDVLNIDEVFQVVKQIVQR
GMQREHPGCHLLMYGSCVNGLALKGNSDLDMTLIIDNLEIDHQNVLRKIESLLRSKNSNY
GNRFQNLHIKMIKSGAHITFLDKETNIDLEISINKILEVYNSQLLYTYALADARFHKLVV
LLKKWNKNNFPDASRRINSYSIVLMLLAVMQGEKIMPKLQIINREEGQQRMIRYQKYVQN
PNNFNLINTIYEADVYFESDLDQIGKSFKPAIYLPSKKLHTPAEILILFFRTYIFLFNST
NHGIDVTNNVQFKDKSLIKLEILKQFQESDTYIQANVLNDIKNFTFMIVDPFDKSYNPAK
ASRIGCDLEKNFFKKLNETFDDLMNDQKFDQFIKWR