Identifiers and Description

Gene Model Identifier

Contig19254.0.g44

Standard Name

GLD2a

Aliases

Contig19254_0_g44

Description

Cid1 family poly A polymerase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010503600.00000000000020009182674645818Nucleotidyltransferase domain
containing protein
SGDYOL115W0.00000019998969434520019PAP2 SGDID:S000005475, Chr XV
from 101475-103229, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19254.0.g44(coding)
ATGTAACAAAACCCAGAGTTCATTGCTTCTCAGTCACAATCCCCCTCCCTAAGAGAATCT
TTCGAAGCCCTTAAGAGCATCTCTGAGGCAGACTTCGCAACATCCCAACAGGAAAAGAAG
AAATTCGAAGTTATCACTCAAGCATTTAAGAAAATGAAGGGACTCAATAACGAGCAGCTG
CCTGAGTATGTTCAACTCATGAGGAGACTAGTCGAGTTCATTGTTACTCCATCTTATATC
AACTACTACAAGAAATACGACAAGAAGTTGAGCAAGAACATTCTTAAGCGCTGCGTGGTA
GAACCCTTCACCGATAAATTCATGAAACCAAAGGAAGTGCCCAATGAAGGGCAGGATGCC
TCAAGACCCCTGAAGACATTCGAACTGGCGAGATTCACAAGCACGCATCCAAAAGTATTT
GAAGACTTAAATAAAGTGTTCTGCGTGCTTGAGGAGCACGATGAGCTCTTGACTGAGAAG
CTCAAGGTTAATCTCAGAGATGCTTTTGAATAGTATGTCAAGCTCATTGAAAGCAAACCT
GAGTTAGTAGATAAATTTGGAAATTTGGTTATGGGATAACTCAGATCACTCTTAACTCAA
TGCAATATAGCTGATGACGATGTGTTATTGGAGACAGGCAATAAAGCTAAAATTGTAGAT
TTATTCAAGGGCAAGAAGACTCAGAAAATGTCCATCTACATCAAAGAGCTTTTACTGATT
GAGAACTAGGTTCAAAGGGAGAAGAGGTTTTTGAAGAGAATGTTTTCGGAGAAGCCCCAG
TACTATCATTTCGTCAGGGACAACACTATTTGGATATTGGAGAAGTACAACTATGATTTC
AGCAAGGAGGAGGTTAGAGGGTTCCTGGCTTACTTAAATAAATTAGCAAAACATCTAGTC
TAAGATAAACAAGATTTGGCAATTAAGTTTGACAATTTACTTAAGGACTTCCTTCAAGCT
CAATCAGCTAAGTTCCCCGATTTGAAGCTGAAAGATTTATACTCAGGTATGTTTAGTCCA
TACTATTCAGCAAAGCAACTACAAGACTTTAATAATTAGTAAGAAAAGAAAGTGGAGAAA
AGTGTACCTAATAGCTAAGGAGCTATAAGTGCAAACAAAGAAGGAGGTAGTTAATAGTAA
GCAGCAAATTCAGGAAGTAACAACAATAACAACTCAAAACAATATGTTAAGAAACAACCA
AAGTAGAACCAATTCTAGTCTAATAAGTTAGAAGGTTTTATTGATGAGATGCTTGGTGCT
CTCGCAGAAGCAACCAAAAAGGACTATGCATAAATCGATGATGATATAAAAGATAGAGCT
CTTCAGCATTTCAAGGCTGAATTCGGTTATCAAGAGCTAAAATACAGAATATTTTAGATT
TTGGATTCTAGACTTGCTACTTTTAAAACTCAGTTCCAAGCCAGAATATACTAAAAGGTT
ATAACTGCAATTCAAAAGTGCAACATCTTGGACATTCAAGAAATCAACGTGCTTTTCTTG
AAAGCCAAGCGATTCCTAACCAAGGAAAGCGTTAAGAAGGAGAAAGTCAAGATCAGAAAT
GACATTAAGAGTAATTTCATAGCAGGGATGGGAGCAGTCGATCACCCAGACAAGGGTGTA
TTTGTGAATGCCAAAGGTGAACTTAAACAAGAAACAGATAGTGATGACAGTGGTTTTGAG
GATGTAGAGGATGACGTTGAAGATTACGAGTCAGAGGAAGACAACAAGAATCAAGGCAGT
GGAAACAACAAGAGTAGCGACAACAAACAGCAATAAGTGAAGATGATTCACAGATACTCA
TCAGACAGTGCGGAGTTGTTCAAGCAACCACCACCAAAGAACAAGAGACATCAGAAGGAA
GACCCAGCTAACACCATGTACTTGAAGTCATTCAGAGACAAAACAGAAACTGAACAAGCG
AATCACTATTTTGATATTAGAACTCAACATACTATTTCTCCAGAGCAATTGAAATCAGTG
AAAGGATAGAAGATGCTGCTTGGAGTCGAAGGGATTATAAAGCAAATTTATAAAGAACAG
AGTGTCAGCAGGGAGGATTTAGCGATCAGAGATAGAGTCATCAACAATATCAAGAATGCC
TTCAAAAACACTAATGACAGAGAATATCCTGCTCTATTAACTGGATAATTAAGAATCAGT
GGTTTTGGTAGTTGCCAAAACGGACTTTGGAATGTTGAAAAGTCAGATATTGATGTGACA
TGTATTATAAGTGAGAAAATAGAGTTTAACCAGCACTAACTTCTCAGAGCATGCACTACA
ATTATCAAGAAAGTTGCCAAATAAGGCACTCTTATTTTTGTTCCAGCTTCAAGAGTCCCA
ATCTTGAAATTCCAAGAGAATCAAACTGGCTTAGAAGTTGATTTCAATGTCAACAATATC
CTAGGAATCCATAACTCTGACTTGATATTTACCTACTGTCAAATTGATTAGAGATTCCAT
ATCTTATCACTGTTCTTGAAGTACTGGTCCAAAAAGGTTGAAATTATTGGAGCTGCCTAT
GGACTGCTCAGTTCTTATGCTCTCACTTTAATGTTAATCGCTTTCTTACAAAGCACCTCA
CCCCCTGTCTTGCCATGTCTCTAACAAAAGAAACTCAGGGAAAGACAACATAAGAGAAAT
GTGTTCTATCCGATGCCAATTGACTAACTTGAGAGCAAGAGACGCAGAAACGCATTGGGC
AGTTCAAAGTCCAAAGATCCAAGTAAATCAATGTACTGCCTGACTGAAACGGATACTTTC
TTCGAAAATGACTTCAAAGTCATTCAGGAGTTCTACATGCCCAAGGAAAAGAACAATAAG
AGCTGCGCTGAGTTGATGTATGAATTCTTCTACTTCTACACTTACGTGTTTGATGCAAAC
AAGCAAGTCATTGATATCAAGAATGGCACTGGTTACTCTCCCAAGTGCTCAAGAGATAAG
TATCCATTCTCAATTGTAGATCCATTTGAACACTAGCGTAATCCAGGATGTAGCGTGTTC
ATGGGCTCAGACGGTCATAGAAAGATTATGATGCATTTCAGATCAGCACTAGATAGATTT
AAACTTAACTGA


>Contig19254.0.g44(protein)
MQQNPEFIASQSQSPSLRESFEALKSISEADFATSQQEKKKFEVITQAFKKMKGLNNEQL
PEYVQLMRRLVEFIVTPSYINYYKKYDKKLSKNILKRCVVEPFTDKFMKPKEVPNEGQDA
SRPLKTFELARFTSTHPKVFEDLNKVFCVLEEHDELLTEKLKVNLRDAFEQYVKLIESKP
ELVDKFGNLVMGQLRSLLTQCNIADDDVLLETGNKAKIVDLFKGKKTQKMSIYIKELLLI
ENQVQREKRFLKRMFSEKPQYYHFVRDNTIWILEKYNYDFSKEEVRGFLAYLNKLAKHLV
QDKQDLAIKFDNLLKDFLQAQSAKFPDLKLKDLYSGMFSPYYSAKQLQDFNNQQEKKVEK
SVPNSQGAISANKEGGSQQQAANSGSNNNNNSKQYVKKQPKQNQFQSNKLEGFIDEMLGA
LAEATKKDYAQIDDDIKDRALQHFKAEFGYQELKYRIFQILDSRLATFKTQFQARIYQKV
ITAIQKCNILDIQEINVLFLKAKRFLTKESVKKEKVKIRNDIKSNFIAGMGAVDHPDKGV
FVNAKGELKQETDSDDSGFEDVEDDVEDYESEEDNKNQGSGNNKSSDNKQQQVKMIHRYS
SDSAELFKQPPPKNKRHQKEDPANTMYLKSFRDKTETEQANHYFDIRTQHTISPEQLKSV
KGQKMLLGVEGIIKQIYKEQSVSREDLAIRDRVINNIKNAFKNTNDREYPALLTGQLRIS
GFGSCQNGLWNVEKSDIDVTCIISEKIEFNQHQLLRACTTIIKKVAKQGTLIFVPASRVP
ILKFQENQTGLEVDFNVNNILGIHNSDLIFTYCQIDQRFHILSLFLKYWSKKVEIIGAAY
GLLSSYALTLMLIAFLQSTSPPVLPCLQQKKLRERQHKRNVFYPMPIDQLESKRRRNALG
SSKSKDPSKSMYCLTETDTFFENDFKVIQEFYMPKEKNNKSCAELMYEFFYFYTYVFDAN
KQVIDIKNGTGYSPKCSRDKYPFSIVDPFEHQRNPGCSVFMGSDGHRKIMMHFRSALDRF
KLN