Identifiers and Description

Gene Model Identifier

Contig825.1.g128

Standard Name

GIMIP1c

Aliases

Contig825_1_g128

Description

AIG1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig825.1.g128(coding)
ATGACTTTAAGAAAGAATCGTAAGTACGAAGAAGATGAAGAAGAGGAGGTAAAAGGAAGT
AGAACTTAGTCAAAATCTACAAATTAAGAAGATGATATCTATTTGGAGAATATCCTGGAC
ATCCCAAAGAAAAGTATGCCTGATTTCTAGGAGCTTATCAACTTACAGAGGAACAACTCT
GGCAAATATTTTCTGAGTAAAAAACGCCAGGAGATTGATAACCTTTCAGCAAAGTACCCT
TGCATTTGTATGATAGGTGTCACTGGACATGGAAAGTCTTCAACTGGAAACACATTAACC
GGCATCAAAGACATTTTCAGGGTTTCTTGTAGCTCCAAATCTGAGACCTTTGTCTGCTAA
GGTGTTGTGACTAACTGGTTTGGTAATACCAAAGAAAGCCAACTAATTGCCCTAGACACT
CCAGGTCTAGGAGATAGTGAGGGGAGAGACACCAAGCACATAGCTAATATGGTCAAGAGC
TTGAAGAGCATAGGCTATGTCAATACGTTCCTCATTATAATAAACAGCTAAGAACCTAGA
TTTAATGAGATGCTCAAGCAAAGTATCAGGCTTTTTGAGTAAATGTTCGGCAACGAATTT
TTCAAGAACATTTTGATTTGCTTCACAAAGTTTCAATATGATCAGAGGACTCTAAACCAA
CGTCGTAAGGGAAAGTCATCCTCTGAGGATCAGATAAAATCTGAGTTTGTCTCCAGATTC
TAAAAAGATTTTAAGCATACTCTGGAATCTAACCAATTCGTTTTCATTGATAATATGGTC
TTTGCTGACGAAGAAGAGGATTATGAAGAGCTAGAGGAAAGAAAATTCAAAGAAGCCAAA
AATCATATAAAAAATATGACTCTGAACAATCCAGTCTTCTACTGTTAAGATATCAAGGAA
GCTCAAAAAGAAAACGATAGAATTAAATAGGAGATGGAAGAACAGAAGTAGAAGCATGAG
GAGGAGAAGTCATAAATACTACTCGAATCTTAGAAAATACTGAAGTAGGAGCAAGATCTT
AATTAGAAGAAGCAACAGTAACTTTAAGATACCCTAAACCAAGAAAAGCTGAGATTTGAA
AAAGAAAAGAAGGAGCAAGCTGAGAGAGACAGAATAGAGAAGCAACAGTTGAAAGACGAG
AAGGAAAAATTACTTAAAGAGGAGAGAGAAAGAAGTGAACGAGAGAAACTTCAGCTGAGA
GAAGAATTGAAATATGAACAGTAAAAATAGCAGAGACTGCTAGAAGAATAGAGATCATTT
AGCTAGTATTCAATGAACAGTGGTTATTAACAACAATCATATCGGCCGTAACCAGACTTG
TCAAACTTATTAGACAGTTTATTCATGGGCAGTGAAAATAGCTTCTCTTACAATAAACCA
AATCTTTACCAAAGACAAGAGCCTTATTATTCTTAGGGTTCAACCAACATCTCATAAATT
TCAAACAACAAGAAAGCTGAGATGTGCAGAGAATATCAGCAACTTGACAAGAGAGTGTAA
AAGCAAGCAGACGCTAGTTTCACTTAAGATGGAAAGGTTGACCATCGTGTTCACAGAGTG
TTTGGGATGAATGTTGATGGGACCGTAGATAGGAGAACTAGGGAATACAGAGATTAACAT
AATAGATGA


>Contig825.1.g128(protein)
MTLRKNRKYEEDEEEEVKGSRTQSKSTNQEDDIYLENILDIPKKSMPDFQELINLQRNNS
GKYFLSKKRQEIDNLSAKYPCICMIGVTGHGKSSTGNTLTGIKDIFRVSCSSKSETFVCQ
GVVTNWFGNTKESQLIALDTPGLGDSEGRDTKHIANMVKSLKSIGYVNTFLIIINSQEPR
FNEMLKQSIRLFEQMFGNEFFKNILICFTKFQYDQRTLNQRRKGKSSSEDQIKSEFVSRF
QKDFKHTLESNQFVFIDNMVFADEEEDYEELEERKFKEAKNHIKNMTLNNPVFYCQDIKE
AQKENDRIKQEMEEQKQKHEEEKSQILLESQKILKQEQDLNQKKQQQLQDTLNQEKLRFE
KEKKEQAERDRIEKQQLKDEKEKLLKEERERSEREKLQLREELKYEQQKQQRLLEEQRSF
SQYSMNSGYQQQSYRPQPDLSNLLDSLFMGSENSFSYNKPNLYQRQEPYYSQGSTNISQI
SNNKKAEMCREYQQLDKRVQKQADASFTQDGKVDHRVHRVFGMNVDGTVDRRTREYRDQH
NR