Identifiers and Description

Gene Model Identifier

Contig4033.0.g61

Standard Name

GIMIP1b

Aliases

Contig4033_0_g61

Description

AIG1 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04548 ) AIG1 family
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam12128 ) Protein of unknown function (DUF3584)
  • ( pfam00910 ) RNA helicase
  • ( pfam14362 ) Domain of unknown function (DUF4407)
  • ( pfam05141 ) Pyoverdine/dityrosine biosynthesis protein
  • ( pfam06217 ) GAGA binding protein-like family
  • ( pfam13671 ) AAA domain
  • ( pfam05279 ) Aspartyl beta-hydroxylase N-terminal region
  • ( pfam08432 ) Fungal protein of unknown function (DUF1742)
  • ( pfam02724 ) CDC45-like protein
  • ( pfam02932 ) Neurotransmitter-gated ion-channel transmembrane region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER008C0.00010003404299092957SEC3 SGDID:S000000810, Chr V f
rom 171818-167808, Genome...
T. thermophilaTTHERM_003558100.00020003864201578029EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4033.0.g61(coding)
ATGGAAAGACTAAACAACTCAACATTAAAGTTTGAAGATTTCGTAGAAGTGACACCAGAG
TATCAAACTCAATTGCAAAGGATGAAGATAAGCACCGATAAGTATTAGTTAAGAGGATAA
AGATAAGAAATTTTAACTCTTTCAAAAATGTTCCCCTGTGTCAGTTTATTTGGAGTGACT
GGGCAAGGCAAATCAACAACTGCAAATACTTTAATTGGAGAATCGGGATATTTTAAGGTT
TCTGCGAGCATCGAATCTGAAACTACTTAATGCAAGGGCGTTGTTAGGAACTGGTATGGA
GATGAGAAGCAGACCTAACTCTTGGTCCTAGATACTCCAGGTATTGGAGACTCCATGAGC
AGAGACACAAATCATATCACAAATATGGTTTAAAGATTGAAATGTGTTGGCTATGTAAAT
ACATTTCTGATTGCATTAAGCAGCTAAGAACCTAGATTCAACGAGCTTCTAAAGTAGAGC
TTTATGATTTTTTAAGAAATGTTTGGAGATGAATTCTTTAAAAATGTCCTGCTTTGCTTT
ACAAGATTCGCTCACGATAAGAGGTCGTTGAGACAAAGAACAGGAAAAAATTAAAAACAG
TTGTCTGATCTAAAATCTGACTAGTTTGTATTCATTGACAACATAAACTTGGATGATGAT
GATGAATTCGGCTATGAAGATCTAGAAATAACGTAATTTCAAGTAGCCAAAGACGCAATC
AAGGCCTTTACTTTGAATAGAGAAGTCTTCATATGTCAAGATATCAAGGAAGTCCAAAAG
GAAAACGATAAAATTAAGTAGGAACTAGAAGAACAGAAGAAAAAGCATGAAGAAGAGAAG
AAAAGACTGGCTTTAGAACAAGAAAGGAAGCTTAAACTTTAAAAAGAAGAAAGTCTTAGA
AAGTAAAAAGAAATGGAGGAGACTCACAGGAAAGAGTAATTGAAAATACAGAAGGAAAAG
TAAGAACAGGAGGAGAGAGCCAGGAAAGAAAAACAGAGGCTTCAAGAAGAGAATGAAAGA
TTGGAGAGACGCCTCAATCAATCATCTTATAGCAGTTCATTCTATCAGCCTTCATATAGC
AGTTTTCTTGGAGGTGGTTATGGCGGCTGTGGTGGAGGTAGTTATAGCGGCTATGGTGGT
GTATCATCCTCAGGATAGTCAACAACATCATAATCTTCATAATCTAGTTCAGGTAAATTG
ATGATCGATGGAAGAGAATGCGCTAGATTAACAGCTAAAGGCTTACCTGACATGAGGTAC
ACGATAAACAAATAAAACTTTGGAAAAAAGTGA


>Contig4033.0.g61(protein)
MERLNNSTLKFEDFVEVTPEYQTQLQRMKISTDKYQLRGQRQEILTLSKMFPCVSLFGVT
GQGKSTTANTLIGESGYFKVSASIESETTQCKGVVRNWYGDEKQTQLLVLDTPGIGDSMS
RDTNHITNMVQRLKCVGYVNTFLIALSSQEPRFNELLKQSFMIFQEMFGDEFFKNVLLCF
TRFAHDKRSLRQRTGKNQKQLSDLKSDQFVFIDNINLDDDDEFGYEDLEITQFQVAKDAI
KAFTLNREVFICQDIKEVQKENDKIKQELEEQKKKHEEEKKRLALEQERKLKLQKEESLR
KQKEMEETHRKEQLKIQKEKQEQEERARKEKQRLQEENERLERRLNQSSYSSSFYQPSYS
SFLGGGYGGCGGGSYSGYGGVSSSGQSTTSQSSQSSSGKLMIDGRECARLTAKGLPDMRY
TINKQNFGKK