Identifiers and Description

Gene Model Identifier

Contig17157.0.g68

Standard Name

GGH1m

Aliases

Contig17157_0_g68

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010274709.997975313387782e-28glutamine aminotransferase cla
ss-I family pro...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17157.0.g68(coding)
ATGTATTCTATAAACCAAAAACATTTAAAAACTTCACCTTCTTCAGAGAATCAGGTCATT
AATTCTCCAAGAAATTTAAATTTTTGCATCTAGAAATTATTCTCTACTCAATATGTGAAA
ATACTGATTTTGCTATTGATATCAACTTTCCAGATAGAGTGCCAAGCTCAATCAACTGGC
GATATGGGTTTCTTGAAAACTTTTAAAAATGCGAACCCAGTAGTGGGCGTCCTTACCATT
CCCGGGAAGCCAGAATTCATGTCTTACATTGGAGCATAGCAATTTATTTTCTCGATGAAC
GAAAGGTTCTTTGCTAATGCCTCTATTGACTCAGTGGCGATACCCTATAACATAAATGAG
AAAGACTTGTACGATATCCTAGATAGAATAAACGGAGTGTTTTTCACGGGAGGATCCCTA
GACCTGTTCAACGAGACTACTGATGAACTTCATCCCTATACCATAACCTCACAAAAAATC
ATGACATACGCACTTTAAAAAACTGACTCTGGAGATTACTTCCCCATCGTTGGTATATGC
TAAGGCATTGAACTTCTGCACATAATAGTGGCTAACAATACGAAAGCACTAGGGTGGTCG
AAGTACGAGAACAAAGACATCTACACAGAAATAGAGGACCCTATCGACAGAAAGTAAAGC
AGATTTTTGAATTCATTGAGTGAGGAAGTGTACTAAGCTATCTAGGGTTAAGACATGCTC
TATCACCTTCATCACAGAGGTATACCATCAGCTTTCTACAAGACATTTCCTTAACTGAAC
GACTTCTTTAACATTTTAACAGTGAACACTTTTGATGGGTAGGAAATAGTTTCCACGGCT
GAAGCTTGGAACTACCCTGTCTATGTTTTCTAATACCACCCTGAAATAGTGTATGAAGAT
GATGCGACAGACATTTAAACAGACAAAAGCCCACATTCCTATAGATATGCTCAGGAACTG
GCCAGATTTCTCAGAGAAGAGATGCTCAAAAGTAGCCACCAGTTCGACAGTATTGAGGAA
ATCGATAGAATAAGAGTTAAAAATGGGTTTAAAGGAAAATTAGGGTATATCTGGGAGTTT
GCAGAGACATATGGATTTAATTATTGA


>Contig17157.0.g68(protein)
MYSINQKHLKTSPSSENQVINSPRNLNFCIQKLFSTQYVKILILLLISTFQIECQAQSTG
DMGFLKTFKNANPVVGVLTIPGKPEFMSYIGAQQFIFSMNERFFANASIDSVAIPYNINE
KDLYDILDRINGVFFTGGSLDLFNETTDELHPYTITSQKIMTYALQKTDSGDYFPIVGIC
QGIELLHIIVANNTKALGWSKYENKDIYTEIEDPIDRKQSRFLNSLSEEVYQAIQGQDML
YHLHHRGIPSAFYKTFPQLNDFFNILTVNTFDGQEIVSTAEAWNYPVYVFQYHPEIVYED
DATDIQTDKSPHSYRYAQELARFLREEMLKSSHQFDSIEEIDRIRVKNGFKGKLGYIWEF
AETYGFNY