Identifiers and Description

Gene Model Identifier

Contig532.1.g128

Standard Name

GGH1l

Aliases

Contig532_1_g128

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam07722 ) Peptidase C26
  • ( pfam00117 ) Glutamine amidotransferase class-I
  • ( pfam13507 ) CobB/CobQ-like glutamine amidotransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005644501.0002869940498747e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig532.1.g128(coding)
ATGATTTTGTCGATACAAATTGCTAATATTTCTGGCCTAAGATCATCAGCATTTTTATAA
AAGAAATTAACTGTTCTGAGCCAAGAGAATGAAAAGACCATTGAAAATCCAACAATTGGT
GTGCTTACTATTCCTTTGGATAGACCTGAGTTTTATCAATACACTAACGCCTCTTCCTAC
ATCTTCACTTCAAATTATGAAATGTTTGTAAATTCCTCAATAACTCCAGTGTTTATACCT
TATGATGCCACTGATGAAGATTTGTAAAGATTACTCGCATAAGTTAACGGGGTATACTTC
TCGGGAGGAAGTCTTATTTTAATTGACCCTTATACTGGGATAAAGCATCAATATACTTAG
ACAGCCGAAAAGGTACTTAATTTTGCGAAGGAAAGATATAACAATGGAGTACATTTTCCT
ATTCTTGGAGTTTGTTAGGGTTTTTAACTTCTTCAAGTTCTCGAGTTAAATCACACAGAA
TTTTTGAAAAAAATTGAGCTAGAAAACTTATAAACTCCAGCTAATTTAACTAAAATGTCA
ATAGATTCAAAGTTAATTTAAGCTTTTACTCCAGTAATTTAGAGTGCAATATAAAATGAA
AATATATTATTTCACTTACATCACAATTCTGTTCTAATTGAAATGTATGAAAAGTATCCT
TAACTTGGAGAAGCATATAGAGTTTTGGGAACTACAAATTGGATTTAACCTGCTGGAAAT
TACACTTAATATGAATCTAATGATACCACTAATGTGGATATTTACACTGAACCCACTCAA
GTGACCATTGCAACGATTATAGAGCACCAGACCTACCCCTTCTATGGAATGGTAGTCCAC
CCAGAAATGTACTATGAAATCGCTGTTGACGTTTAAGTTTCCAAGTCTGATAACCAATAT
CAATACCTTCACTAACTTGGCTTGTTTTTGCGAAGTGAATTGTTGAAAAACTAACATAAA
TTTGAGAGCAATGAGGAGTTGGAAAAGTGGAAAATGAGCAATGGGATTAAGGGGGTTTTG
GGAATTATTGATTATCCTAGCTCAACACTTGGATTCAATTATAAACCTAAATTATAATAA
GACAAAGAATGA


>Contig532.1.g128(protein)
MILSIQIANISGLRSSAFLQKKLTVLSQENEKTIENPTIGVLTIPLDRPEFYQYTNASSY
IFTSNYEMFVNSSITPVFIPYDATDEDLQRLLAQVNGVYFSGGSLILIDPYTGIKHQYTQ
TAEKVLNFAKERYNNGVHFPILGVCQGFQLLQVLELNHTEFLKKIELENLQTPANLTKMS
IDSKLIQAFTPVIQSAIQNENILFHLHHNSVLIEMYEKYPQLGEAYRVLGTTNWIQPAGN
YTQYESNDTTNVDIYTEPTQVTIATIIEHQTYPFYGMVVHPEMYYEIAVDVQVSKSDNQY
QYLHQLGLFLRSELLKNQHKFESNEELEKWKMSNGIKGVLGIIDYPSSTLGFNYKPKLQQ
DKE