Identifiers and Description

Gene Model Identifier

Contig19253.0.g52

Standard Name

GGH1k

Aliases

Contig19253_0_g52

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam07722 ) Peptidase C26
  • ( pfam00117 ) Glutamine amidotransferase class-I
  • ( pfam13916 ) PP1-regulatory protein, Phostensin N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005644507.002638123733849e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19253.0.g52(coding)
ATGAGAAATTCTACACGATTGGAGTACTCACTTAACCGATAGATAAACAAGCTTTTCTTA
GAGGATGCGGGGAATGTGCGGGTCGTCCCTCTCTACTATGATGAATCTGATGATATTATG
CTCTATAAGTTACTTTCAAAATTAAATGGTGTACATTTCACAGGAGGAGGTCTCACTCTG
ATCAACCCCGACACTCGCGAACAACATTAGTACTACAAAACAGCAAAGAAAATTTTGGAG
TATTCTATTCAGTAAAAAGACCAATTCAACATAGATTTCCCAATAACTGGAATCTGCCAA
GGTTTTGAGGCACTCGTGATGCTAGTTGCTGGGGATAACCACCAGCTTCTACAGAAAATT
GCTTATTTCAATTAATAGAGAAAGATTCAATGGACTGCAGATAATAGTGGGGATGAGACT
GGATCATTCACAAATGTTAAGAAGGAGAGCAAGATTTTTTCATTGTTTGATTAAGAAATA
ATTGATAAACTTGGAAGCCAAGAAAACGCTCTCCACCTTCATGACTACAGTACTTATTAG
GATGATTTCATGAATAACGAGAAACTAAACCAATTCTTCAAGGTTATAGCTACCGATACA
GACCCACTCAATGAGAAACCCTACGTCATCATAATAGAAGCTAAAAATTATCCAATTTAT
GCAATGATGTTTCATCCTGAGTATCAACTTGTAGACTAGTCTAATTACCAGAATAAACAG
ATGAAGTTGAATTCACTGGAGAATGAAGTCACTCAATACACCTACAAAGCACTTTCTAAA
TTCATAAAATCTCAGCTAATGCTAAATTCTCACTAATTCGGGTGGGGACTGATTGAGCAG
TTCGCTCTCTAAACCTCAGATGTAATTATTAATGGTTAAAAGATTCAGACTATTGAAGAT
TACATGATGGTAGGAGATTTGACTGTACGCGCTTATGCCTTGCAAAACCCTAGCAAATAT
ATGGACTAGTTCAGATCTCAGTAAAGCAAATAGAACGACTCTATTTCAGGTCAACTTAGT
AATAAAGTTGTCACATCAAACTAGTAGAACGGATTTCTGCAGAATAATGCAGAAACTTAA
AATGAATAATAACAGCAAAACATTTTAGTGGATTTAAGAAAAAAAGTGCCACTAAGTCCA
TTTGGATTAGGAAAAGATTGA


>Contig19253.0.g52(protein)
MRNSTRLEYSLNRQINKLFLEDAGNVRVVPLYYDESDDIMLYKLLSKLNGVHFTGGGLTL
INPDTREQHQYYKTAKKILEYSIQQKDQFNIDFPITGICQGFEALVMLVAGDNHQLLQKI
AYFNQQRKIQWTADNSGDETGSFTNVKKESKIFSLFDQEIIDKLGSQENALHLHDYSTYQ
DDFMNNEKLNQFFKVIATDTDPLNEKPYVIIIEAKNYPIYAMMFHPEYQLVDQSNYQNKQ
MKLNSLENEVTQYTYKALSKFIKSQLMLNSHQFGWGLIEQFALQTSDVIINGQKIQTIED
YMMVGDLTVRAYALQNPSKYMDQFRSQQSKQNDSISGQLSNKVVTSNQQNGFLQNNAETQ
NEQQQQNILVDLRKKVPLSPFGLGKD