Identifiers and Description

Gene Model Identifier

Contig19054.0.g66

Standard Name

GGH1j

Aliases

Contig19054_0_g66

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005644501.9996410647472548e-29hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19054.0.g66(coding)
ATGGGATTGAGCAATGCTTCTGGTAATAAAGAGTGCTACCCAGCTTTTGGAGTTCTCTCA
CAACCAGTTTCTAAAGCTAACTTGGCAGGATTCTAGAACGATTAATACATTTTAGATGTA
AATCGTGAGTTCATAGAGCTTGGAGGTTCTTGCGCCATCCCCATAAACTATGACATTTCA
AGAGAAGAACTTTTACAACTATTGCCCTCACTAAACGGAGTACTATTCACAGGTGGTGGA
TTGGATTTGATAGACCCAGTGACCCAAGCCCAACACCCCTACTACAAGACAGCCAAGATC
ATCTACGACTACGCCATCCAGCAAAAGGACTCCCAGAGGCAGCAGTAAACTTAGTAAAAT
ACTGACTAGGGAGAATTTATTTTGATGGGAGTATGCCAAGGTTACTAACTTCTGAGTATG
CTGGCAGCTGGAGACATCTATACTTTGGAGAGAATTCCTGCTCTTAATGTTAACAGAAAA
ACTAACTGGACTGTACATCCAACCAATCAATCTCGTATGTTTAAAACCTTGACTGAGGAG
ATTATAAAAGGGTATGAACAGCAAGAATTAGCTTTCCATTTCCACAATTTCGGAATATCT
ACTTCAAGATTCCAAAGCCTTCCAAATTTGAGTAACTTCTTCAATGTACTGCAAACAGAC
AACCTCAATGGCCTAGATTACGTTGTAGCAATTGAAGCGAAAGAATATCCGATATATGGA
GTTCTGTACCATCCCGAGTACCAGATGCTTGACCACAAACAGCCCTTCTCCAACAACAGA
AACCTCCTCACCATGAAAATCGCTCAACATTTCTCTACTTTTATGAATAAGGAAGCCACT
AAATCTAAGCGTATTCTATCTTCAAGCAAGCTATCGGAATTGTTTGCTCTGTAATCTTTG
TCTCGTTTGCAGCCTTTACAATATAACTTAGGTGCAAATTAAATGATCAGTGCAATTGGC
TTAAATTCAGCAATTGCTAAAAGTTTTTATGTGAAAGTAGATAGCCAGGCGTGGACTGAT
GGTCTTGTCACGCCCACCATTAATCTTACAGAGATTAGTATTGCATCAGCAACATAAACT
ACTAAAATTCAAGCATAGGATTAAATTACTCAAGCTCATGGTCTACCAGTTATTAAGCCC
CTTATCCAGCAATTATCTCAGATTTAACTATTAGAAGACAATCACTCCTCAGCTGCCTCT
ACAGACAGTAGAAACAGTGGCGCCAATGATTGTGGATTAGAGAGCACCTGGATAAAACAT
GGATTATAGTAAGACATCGTCTAGTTAGACTTAGTTAAGAGCCTGTCAACATCCAGCAGT
GATACTTCCTCTACATTAAGTGGTAATAGCAGTCCTACAGATTCAGCTCAGTCTAATTAA
TTCACTAGCGAAATCGCTCATGAAAACTTGGGAATTAAGGGTCTCGCAATCGCCATGCTG
AGAATGATCCCTATGGAGACTTTCGGTTCTATATGA


>Contig19054.0.g66(protein)
MGLSNASGNKECYPAFGVLSQPVSKANLAGFQNDQYILDVNREFIELGGSCAIPINYDIS
REELLQLLPSLNGVLFTGGGLDLIDPVTQAQHPYYKTAKIIYDYAIQQKDSQRQQQTQQN
TDQGEFILMGVCQGYQLLSMLAAGDIYTLERIPALNVNRKTNWTVHPTNQSRMFKTLTEE
IIKGYEQQELAFHFHNFGISTSRFQSLPNLSNFFNVLQTDNLNGLDYVVAIEAKEYPIYG
VLYHPEYQMLDHKQPFSNNRNLLTMKIAQHFSTFMNKEATKSKRILSSSKLSELFALQSL
SRLQPLQYNLGANQMISAIGLNSAIAKSFYVKVDSQAWTDGLVTPTINLTEISIASATQT
TKIQAQDQITQAHGLPVIKPLIQQLSQIQLLEDNHSSAASTDSRNSGANDCGLESTWIKH
GLQQDIVQLDLVKSLSTSSSDTSSTLSGNSSPTDSAQSNQFTSEIAHENLGIKGLAIAML
RMIPMETFGSI