Identifiers and Description

Gene Model Identifier

Contig5261.0.g11

Standard Name

GGH1g

Aliases

Contig5261_0_g11

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005644409.996273942859018e-26Papain family cysteine proteas
e containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5261.0.g11(coding)
ATGAATCCACTTATTAAAGTGCTGCTCCTCCTAGGTGTTGCTACTTAAACTTATCAATTT
TCTCTTCAAAAATTCCTCAACAATTTGGCTCATTAAGATCATGACCATAGCTATAATGAG
ATCAAACTCAATAAAGTTCCAGAGCTTTAAGCAAAGCCTAAAGTATAGAAAAAGTTGATG
ACTGTAGGTATCCTGACTCAGCCTACATCTGCCTCTAAAGAGAATTACTTGAATCATTCG
CAATACATCTTTGAAATGGGCGATATTTGGATGCGCTCAGCTGGTCTTAATGCTGTGTAT
ATTCCTTATAATATTACAGACGCCGACCTCTACCCACTCTTAGAATCTGTTAATGGAATT
TTCTTCACTGGAGGAGGCTTGGATTTGTACAACTACACAACTTGGGTTCCTCACCCCTAC
ACAGTCACTGCTGAGAAAATTTTCAACTACACCATTGCTTAGAATGACAAAGGAATCCAT
TTCCCAATCCTAGGAGTATGCCAAGGACATCAACTTTTACATTTAATTGTTGCACAAAAT
CCTACAGTTTTAGGCAACTCTGAACTGGAAAACAAACGCACAAACACAATTTTCACTGTT
GAGCCTAAGAAAAGTAAGATCTTTTCTACTTTCAGCAAAGATGTCATTTAAGCAATGAAC
AATACTGAAGTACTTCTTCACTTGCATCATCACGCTATTTCCTAGAACGCTTATTTCATG
AACCCAAGTCTTATCAGATTCTTCAACGCTGCAACAGAGAATATTATAGATGACTAGATC
ATAATCACCACTGCTGAAGCTCAAAATTATCCAATATACTCTGTTTAATATCACCCAGAA
GCTGTTCTGGAGCCTTCCTAAGATATTAATGCCACTAGAAGCTTAATGGGTTTCAAGATT
GCTTAATGA


>Contig5261.0.g11(protein)
MNPLIKVLLLLGVATQTYQFSLQKFLNNLAHQDHDHSYNEIKLNKVPELQAKPKVQKKLM
TVGILTQPTSASKENYLNHSQYIFEMGDIWMRSAGLNAVYIPYNITDADLYPLLESVNGI
FFTGGGLDLYNYTTWVPHPYTVTAEKIFNYTIAQNDKGIHFPILGVCQGHQLLHLIVAQN
PTVLGNSELENKRTNTIFTVEPKKSKIFSTFSKDVIQAMNNTEVLLHLHHHAISQNAYFM
NPSLIRFFNAATENIIDDQIIITTAEAQNYPIYSVQYHPEAVLEPSQDINATRSLMGFKI
AQ