Identifiers and Description

Gene Model Identifier

Contig21779.0.g57

Standard Name

GGH1e

Aliases

Contig21779_0_g57

Description

Peptidase C26

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam07722 ) Peptidase C26
  • ( pfam00117 ) Glutamine amidotransferase class-I
  • ( pfam13507 ) CobB/CobQ-like glutamine amidotransferase domain
  • ( pfam07685 ) CobB/CobQ-like glutamine amidotransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001294101.999790113608142e-24glutamine amidotransferase cla
ss-I family pro...
SGDYNR033W0.000008000552149328928ABZ1 SGDID:S000005316, Chr XIV
from 687635-689998, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21779.0.g57(coding)
ATGCAAGCAACCAGCGTTTAGGGAGTGTCAGACTCAGATCAAGCAGCAGCTTTGTAACAC
CAACCACTTATTGGAATCGTGACCATGCCCAAATAAGCAGCAGGTCCAATGGGAGATCTT
GGGAGAGAATAGTACATTTTGGATATAAACAGGGGTTTTATGGAATAAGGTGGTTCTAGA
GTTGTTGCCATCAGTTACGACATAAGCCATGAAGAATTAATAAAAATCCTAGACAGCATT
AATGGAGTTTTATTGACAGGTGGAAATGTAGTGTTAATTGACCCAGAGACAAAGGAGTTC
CATTAATACTACAAGACAGTAAGTGCAATTATCCACTATGCTATGAGAGCGAAAGACACC
CGATAAGATTCGTTCCCCATTCTAGGAATTTGTCAAGGTTTCTAGATTCTCTCTATGGTG
ATTGCAGGTGACATCAATACTCTTGAAGATATTAAAGTCATAGGTTAAAATAGAAAGAAG
GTTTGGAAAGTTGCTGACCCTAGATCAAACTCAAAGTTGTTCTCTAGATTTGAAGAGGAC
CTTATTAAAGCATTTGAAGAGCAAGAATTGTGTGTACATTTCCACAATTATGCCTTCTCC
GTTGAAAAATTTAACTCTCTACCTAATTTGGCTGATCAACTTTTACTACTCTAGACAGAT
ATCTTAGATGATGGGACTGAGTTCGTTAGCGGGTTTGAAGCAAAGAACTATCCATTCTAC
GCAGTACTATACCACCCTGAGTACTAACAATATAAACCCAATTCCATGTTTAAATTCAAT
AAATGCGATGAAACATTGAGAATTGTGAAACATCTCACTGCCCTTATGTTTGAATAGTCC
TCTCTAAATAAAAACAGACCACCTGCAGGGTACACACACGAGCATTATCCTTTGTTGACT
GAAGTAAACAGAGAAATAGTTGACTAATATTCAAAAATGATGACAGAAGACTCTGATCCA
TTCGTAGCCCTTACTATGGATTCAGGAGCTTCTTACAAATTATACCCTCATTTATTTGAA
AATCAAACCTAATGA


>Contig21779.0.g57(protein)
MQATSVQGVSDSDQAAALQHQPLIGIVTMPKQAAGPMGDLGREQYILDINRGFMEQGGSR
VVAISYDISHEELIKILDSINGVLLTGGNVVLIDPETKEFHQYYKTVSAIIHYAMRAKDT
RQDSFPILGICQGFQILSMVIAGDINTLEDIKVIGQNRKKVWKVADPRSNSKLFSRFEED
LIKAFEEQELCVHFHNYAFSVEKFNSLPNLADQLLLLQTDILDDGTEFVSGFEAKNYPFY
AVLYHPEYQQYKPNSMFKFNKCDETLRIVKHLTALMFEQSSLNKNRPPAGYTHEHYPLLT
EVNREIVDQYSKMMTEDSDPFVALTMDSGASYKLYPHLFENQTQ