Identifiers and Description

Gene Model Identifier

Contig21582.0.g88

Standard Name

GFM2b

Aliases

Contig21582_0_g88

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam00679 ) Elongation factor G C-terminus
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam03764 ) Elongation factor G, domain IV

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010208609.997093137033517e-262Elongation factor Tu GTP bindi
ng domain conta...
SGDYJL102W8.997107083354175e-87MEF2 SGDID:S000003638, Chr X f
rom 231301-233760, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21582.0.g88(coding)
ATGCTGAAACTCTTTAAGACACATATAAGTATTGCTAAAAATCAATCAAGACAAATTGGC
AGAAGATTCTTCGCAGGTGGAACTTTCAAATAAACTAAAGTCTAAACTGGCAAGGAAGAT
ATTCTTACTCAAAACACTATGGAAGAGGTACATTATGGGAATACTGTGATGGATTATATG
GAACAAGAAAGAAAGCGAGGTATTACTATAAGAGCTGCCACAATAGCATTCAATTGGTAT
GGACATCAAATCAATTTGATTGATACTCCAGGGCATGTTGATTTTACAGCAGAAGTAGAG
AGATCTCTAAGAGTATGTGATGGAGCGGTAGCTTTATTTGATGCTATGTAAGGAGTAGAG
ACACAAAGTGAAACAGTATGGATGCAAGCCAATAAGTTCAAAATACCAAGGTTAGGATTT
ATAAATAAGCTAGACAGATCAGGCTCTAGTATTCAGACTACTTTAGAAAGTGTAAAGCGA
AGATTAAAAGTAGAACCAATCTTGGTTAATGTGCCTAGCAACGATAATAATTAACTTAAT
GGAATTATTGATTTACCATCTATGCTACTTTATGAGTATTTGGATGATAAAAGCAAACAA
GTCAATATTGAATAGATTGTAAAAGGACATTCACTTTTTGATAGGTTGATTCACTACAGA
ACGTAAATGATCGAGTAACTTGCTAATTTTGACGATGAGCTTGGAGATTTATATTTATCA
GGAGACTCAATTGAGAATATACCTATAGAATTAATTGATGGAGCAATTAGAAAATCTCTA
CTAACTTAAAAATCAGTTGCCCTCTTTTGTGGGTCAGCTTTAAAAAATAAGGGAGTCCAA
CCTTTACTAGATGCAGTTATTAAGTATTTACCTTCCCCTGTAGATATAGTAGCAAAAGGC
CACAATCCACTGACACAGTAAGATGTTCTTAGAAAAGCAGAGAAAAAAGAAAAATTCTGT
GCTCTAGCATTTAAAGTCGTTAATGATAAAGAAAAGGGACTAGTCACCTTTTTCAGAGTG
TATTCTGGAAACCTTAAAAACAAATCAAAAATATTGAACTCAAACCTTGGCAAAATAGAG
AGAATTTAATCGTTACTTAGAGTGAGGGCTGATGAAGCTTAATTGCTTAATGAAATTGGA
GTTGGAGATATTGGGGCTATTACAGGATGCAAAGATATCAGGTCTGGAGATACTCTTCTA
GAAGAACTTGATGAAGAAAAAATTATATTAGAAGGTGTAAAGATGCCACCCCCAGTATTC
TTTTGCTCTATAGAACCTGAAAACAGCAGAGATTAGCAGTAGTTAGAGTAAATATTATTC
AATTTATCAAGAGAAGATCCATCTATTAGTGTAAAAAATGATGAAGAGACTGGGTAATTT
TTAGTAAGTGGCCTAGGTGAGCTACATCTGGAAATCTTAAGAGATAGAATTTTAATTGAA
TATGGAATAAAATCAGACCTTGGAAAAATGAGAGTAGCTTATAGGGAATCCGTGGGATCA
AGTGCTGAAGGTGAACTTATATTAGATAAGATAATTGGTGGACAGAACTTATATGCTTCT
CTTAAAATGTCTATTGAGACAACTCTTGGTGAAGTAGATGTTCAAGAATTATAAAAGAAA
AAGTTCGATTCTCTTGAATATAGTGAAAATGAAAAAGAAGCCTATCAACTTTCAAAGGAT
TCTTTCAGTTTAGACGTAGACACACTTTAAGAGAGTGGTTTAGGAAATTTCACCTCAAAC
TAATTAGTTTTATCTTTTGCAGAACTTGAATCCAAGTCAGAAAGAGTAAAACTAGAAGGA
GATGAATATGAAGCTAAAAATAAGAGGCAACGAAATGAAGCCACTCAGGCTAGTTTCGAA
ATTTATAGATCTTTAGATTCTTTGGCTATTGAGTGTTAATAATCCATGAAAAATGCTATT
GATGATGTACTCTCTAGTGGTTAACTGCTAGGTTATCCCATTGTCAATGTGAGAGTTTCA
ATTCTTGAAGGGCAGTGGAGTAATATTAGAAGTAGGAATCCAGTTATTTTTCAAATGTGC
GCCACCTAGCTTTTGAAGCAACTTATTGAATAAAGTTAACCAGTGCTCTTAGAACCATAT
ATGAATGTTGAAATTTCAGTGCCAGATCATGTAGTGGGTATGATTTTATCTGATATCACA
GGAAAACGAGGAGGCTCAGTTATTGGAATAAGAAATGTCCAAGCTAGATTCTTTGATGAA
AACGATTCTAGTGCTAACATAGTGGATGAGAAGAAGAAATGCATAAATGCACTCATCCCT
CTCTCTGAAATGGTTGGCTACTCTACTTATCTCAGATCATCCACAAAAGGAGAGGCTTAG
TTTGTCATGAATTTCTCCCATTACGAGAGAGTTGCTGGTCAGAAGCAAGATGAAGTTTTA
AGCAATCCCTATGATTTTTGA


>Contig21582.0.g88(protein)
MLKLFKTHISIAKNQSRQIGRRFFAGGTFKQTKVQTGKEDILTQNTMEEVHYGNTVMDYM
EQERKRGITIRAATIAFNWYGHQINLIDTPGHVDFTAEVERSLRVCDGAVALFDAMQGVE
TQSETVWMQANKFKIPRLGFINKLDRSGSSIQTTLESVKRRLKVEPILVNVPSNDNNQLN
GIIDLPSMLLYEYLDDKSKQVNIEQIVKGHSLFDRLIHYRTQMIEQLANFDDELGDLYLS
GDSIENIPIELIDGAIRKSLLTQKSVALFCGSALKNKGVQPLLDAVIKYLPSPVDIVAKG
HNPLTQQDVLRKAEKKEKFCALAFKVVNDKEKGLVTFFRVYSGNLKNKSKILNSNLGKIE
RIQSLLRVRADEAQLLNEIGVGDIGAITGCKDIRSGDTLLEELDEEKIILEGVKMPPPVF
FCSIEPENSRDQQQLEQILFNLSREDPSISVKNDEETGQFLVSGLGELHLEILRDRILIE
YGIKSDLGKMRVAYRESVGSSAEGELILDKIIGGQNLYASLKMSIETTLGEVDVQELQKK
KFDSLEYSENEKEAYQLSKDSFSLDVDTLQESGLGNFTSNQLVLSFAELESKSERVKLEG
DEYEAKNKRQRNEATQASFEIYRSLDSLAIECQQSMKNAIDDVLSSGQLLGYPIVNVRVS
ILEGQWSNIRSRNPVIFQMCATQLLKQLIEQSQPVLLEPYMNVEISVPDHVVGMILSDIT
GKRGGSVIGIRNVQARFFDENDSSANIVDEKKKCINALIPLSEMVGYSTYLRSSTKGEAQ
FVMNFSHYERVAGQKQDEVLSNPYDF