Identifiers and Description

Gene Model Identifier

Contig645.1.g7

Standard Name

GFM2a

Aliases

Contig645_1_g7

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam03764 ) Elongation factor G, domain IV
  • ( pfam00679 ) Elongation factor G C-terminus
  • ( pfam03643 ) Vacuolar protein sorting-associated protein 26
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam00339 ) Arrestin (or S-antigen), N-terminal domain
  • ( pfam02421 ) Ferrous iron transport protein B
  • ( pfam04548 ) AIG1 family
  • ( pfam03709 ) Orn/Lys/Arg decarboxylase, N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011946609.997093137033517e-262translation elongation factor
G
SGDYLR069C9.997093137033517e-262MEF1 SGDID:S000004059, Chr XII
from 273915-271630, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig645.1.g7(coding)
ATGTCACTTGAGATCAAATTAGACAGAGCAAGCAAATTTTACGAACCTGGTGAAAAAGTC
ACAGGTCAAATCACAATTATTGACAGCTAGAGCCAAATTTAGCACTCTGGAATTATTGTT
CTGGCTGAGGGTTACATGGACACAGTCTCAATCATCAGAGGAAACATCGGACGCCCACCC
ATGAAAGAGGAAGACAGAATTTACTTTATGAAGAAAAAGTTCACTCTTAGTGAGGGAGGT
AAACTTAACACCTCAAACACAATTGCCTTTGATTTTATTCTCGAAGCTACAGAGAGAGGA
GAGAGCTTAGTAGATGCTTACGTTGGAGTTGAATTCTCTATTAACTATGAAGTGACTGTC
ACTTTGAACAAGGGAGGAAAACAATTGAAGGGATCAGATAAATTTTATTGCGCTGTTCCA
GGTGCTGGTATCGATACTAAAATCGGCAGAAGAGATTAACCAAAAGAATTTGGAATTACT
CCAGACAACCTAGAAGCCGCAACAACAAAATCAATGCCAAAATTCAAGTTTGAGGGTTAA
ATTTACAGTGTAAATTGTGCTTTTGGGGAACCATTCGATGGTTATATAATTACAAGGGAT
TCAGAATATGTAATAAAGTCTATTGAGGTGCAACTGGTCAGAGTTGAAAGCTTTGAAGGA
AAAACATTTGCTACAGAAGTGTAAAATATTCAAGTAGCCGATGGAGATGTAATCAGAGAT
ATGGAAATTCCTCTTTACATGTTATTCCCAAAGATCTATTCATGCCCTACCGTTATTCAT
TCAAAGTTCTCTATTGAGTTCCAAATCAACATCATTGTGATTTTCGTTAATGGATATCAG
TTAACAGAGAATTTCCCCATCAGAATCTATCACATTTTACATCATTCGAAAGCTTAAGAA
ATGCAATCATTCTTTAGAACTGCTTATAATTCTTTTTCAGCAGCCCCATCTGCATAGAAA
CAAAGTTTATTGAAAAATGTTACCTAGACCCTAGGCAAGTAATAGACTATAGGAATGAGT
CAATCTCGTATGATGATGCAATCAAATTATTTGATGAATTCAGCCATTACAAGAAGAGGA
TTTTCACTAATTGATCCAAAGATCATGAGAAATATAGGTATTTCAGCCCATATTGACTCT
GGAAAGACAACCATTACAGAGCGTATTCTTTTCTATACAGGAAAGATCGATGCAATTCAC
GAAGTCAAGGGAAGTGATAACGTAGGAGCAACTATGGATAGTATGGAGCTCGAGAGAGAA
AAGGGTATTACTATTAAATCAGCAGCTACTCATAGTGAATGGAAGGACCATCACATTAAC
ATTATTGATACACCAGGTCACGTCGACTTCACAATTGAAGTAGAGAGAGCATTGAGAGTG
CTGGATGGCGCTATCTTATTGATATGCGGTGCATCTGGAGTGCAACCCCAGACTTTAACT
GTAGATAAGCAAATGAAGAGATATAGCGTTCCAAGAGTTATTTTTATTAACAAACTCGAT
AGAATGGGAGCTGACCCCTGGAATTGCATTGAAAATGTTAGAGATAGATTAGGACTAAAC
TGCGCTGCAGTTTAAGTTAATATTGGTATAGAAAATGGTCTATAGGGAGTTGTTGACTTG
ATTAAGATGAAGGCTTTGTACTTCGAAGGAGATAAAGGTGAAAAAGTAGTTGAAAAAGAA
ATCCCAGAAGACATGAAGGAATTTTGCAATTAAAAGAAATAAGAGCTTGTTTCAGTCCTG
GCTGAAAATGATCCAGCTATTGAGGAATATTACTTGAATGAAGACTTCAATATTCCAAAG
GATGTTATTCAAAAAGCAATTAGATCACAAACTATTTCTTAGAAATTCTGTCCTGTATTC
ATGGGTTCAGCCTATAAGAACAAGGGAGTTCAGCCACTCTTAGATGGTGTATTAGAATAT
TTGCCTTCTCCAGATGAAACAGATAATTATGCCTACGAATTGTCAAACAAGACTGAGAAG
ATCAAGGTGGAAATCGATAACAAAAAGCCTTTCGTTGGACTTGCCTTCAAACTTGAAGAG
AGTCAGTTTGGTCAAATTACTTATGTTAGAATTTATCAAGGTAAAATTAAGAAGGGAGCT
ACTTTAACTAATACAGCAACCAAGAAGAAGGTAAAGATTAGTAGAATGGTTAGAATGCAT
TCTAACAATATGGAAGATATCAACGAAGCAGGAGCAGGAGATATTTTCGCTATTTTCGGA
GTTGATTGCGCTAGTGGAGAAACTTTCTGTGATTAGTAAGTAAACTACACCATGGAAGAC
ATGCATGTCCCTGAGCCAGTCATGTCACTCACAATTAGACCAAAGAAATAAGATCAACTT
GAAACTTTTTTGAAAGCTCTTAGTAGATTCTAAAGAGAAGATCCAACTTTTATTGTTAAG
CAAAATTAAGAAAGTGAGGAAATCATCATTTCAGGTATGGGAGAATTGCATTTGTTTATT
TATTGCGAAAGAATGAAGAGAGAGTATGACATTGATTTGGCAGTTGGAAATCCTACTGTC
AACTACAGAGAAACTGTTTCCCAAAAAGCAAGCTTCAACTACCTTCACAAGAAGCAAAGT
GGTGGTGCAGGACAGTTCGCCAGAGTTATTGGTTACATTGAGCCAATCAACGATGATATC
ACAAGTGACGATGCTGATCTAGCTTGCGTCTTTAAGGATGCCAGTGAGGGTTAGAACATT
CCAAATGAATATATCCCAGCAATTGAAAAAGCTTTCCATGAAGCGACAAAGAAAGGTCCT
AAAACTGGTTATCCAGTTGTAGGAGTTAGATACGTCTTAAAAGACGGTCAAACTCACGTT
GTAGATTCTAGTTCTCTCGCTTTCATGATTGCTGCTAAAGCTTCATTTAGAGAAGCTTAT
GAAAAGGCTGGTCCATAAATCTTAGAACCAATTATGAATGTCGAAGTCACCGTACCAGCT
GAGTTTTAAGCTCCAATTATGGGTCAACTTGTTAGAAGAAGAGGTTCTATTACTAATACA
CAAACTAAGACAGGTTTCTTTATTCTCAATGCTGACGTGCCATTGGCATCTATGTTCGGT
TATGCAACTGAGATTAGAGGAGCTACCTAAGGTCAAGGTGAATTCTCGATGGAGTACAAA
ATGCACAGTCCTGTCTCAGAATTCGAAGTTCAAGATATTATAGAAGCCTACAAAAGGAAG
AGACAAGAAAAGGGAGAAGAATTCTGA


>Contig645.1.g7(protein)
MSLEIKLDRASKFYEPGEKVTGQITIIDSQSQIQHSGIIVLAEGYMDTVSIIRGNIGRPP
MKEEDRIYFMKKKFTLSEGGKLNTSNTIAFDFILEATERGESLVDAYVGVEFSINYEVTV
TLNKGGKQLKGSDKFYCAVPGAGIDTKIGRRDQPKEFGITPDNLEAATTKSMPKFKFEGQ
IYSVNCAFGEPFDGYIITRDSEYVIKSIEVQLVRVESFEGKTFATEVQNIQVADGDVIRD
MEIPLYMLFPKIYSCPTVIHSKFSIEFQINIIVIFVNGYQLTENFPIRIYHILHHSKAQE
MQSFFRTAYNSFSAAPSAQKQSLLKNVTQTLGKQQTIGMSQSRMMMQSNYLMNSAITRRG
FSLIDPKIMRNIGISAHIDSGKTTITERILFYTGKIDAIHEVKGSDNVGATMDSMELERE
KGITIKSAATHSEWKDHHINIIDTPGHVDFTIEVERALRVLDGAILLICGASGVQPQTLT
VDKQMKRYSVPRVIFINKLDRMGADPWNCIENVRDRLGLNCAAVQVNIGIENGLQGVVDL
IKMKALYFEGDKGEKVVEKEIPEDMKEFCNQKKQELVSVLAENDPAIEEYYLNEDFNIPK
DVIQKAIRSQTISQKFCPVFMGSAYKNKGVQPLLDGVLEYLPSPDETDNYAYELSNKTEK
IKVEIDNKKPFVGLAFKLEESQFGQITYVRIYQGKIKKGATLTNTATKKKVKISRMVRMH
SNNMEDINEAGAGDIFAIFGVDCASGETFCDQQVNYTMEDMHVPEPVMSLTIRPKKQDQL
ETFLKALSRFQREDPTFIVKQNQESEEIIISGMGELHLFIYCERMKREYDIDLAVGNPTV
NYRETVSQKASFNYLHKKQSGGAGQFARVIGYIEPINDDITSDDADLACVFKDASEGQNI
PNEYIPAIEKAFHEATKKGPKTGYPVVGVRYVLKDGQTHVVDSSSLAFMIAAKASFREAY
EKAGPQILEPIMNVEVTVPAEFQAPIMGQLVRRRGSITNTQTKTGFFILNADVPLASMFG
YATEIRGATQGQGEFSMEYKMHSPVSEFEVQDIIEAYKRKRQEKGEEF