Identifiers and Description

Gene Model Identifier

Contig19332.0.g96

Standard Name

GATB

Aliases

Contig19332_0_g96

Description

GatB/GatE catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBL080C5.0012639607461234e-61PET112 SGDID:S000000176, Chr I
I from 74695-73070, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19332.0.g96(coding)
ATGGAAGGTTTGCATCTTCATTAATAGAAGAAAGAGTAACTCAATGAAACCTTCAAGTAG
TTCAAAGTAAAAATATTTTCATCTCTAACGCAAATTATAGCTTCATTGTGCTCTTAACTG
GCATAAGCAAACACATAGACAAACTATGTAGATCTCGCATTGCCTGGAATGCTTCCAGTT
TTGAATGAGGAATGTTTGGATTTGGCAATTAAAGCCTCTTTAGCATTCAAAGGGCACATT
AACCCAAAAATAAAGTTTGATAGAAAACACTACTTCTACTCTGATATGCCGCAAGGGTAC
TAAATTACTCAAAAGAATTACCCAATCATGGAAAGAGGGAAGCTTTACTTTTATGATCGT
AATGGGAAGCCTAAATTCATAAATATACAAAGGATTTAAATGGAACAGGATTCAGCTAAG
AGTTTCCATGATTTATAAACTCATACTCTGATTGATTATAATAGAGCAGGAATGCCACTT
TTAGAAATTGTTACAGAGCCTGAAATTGATCATCCTGAAGATGGAAAATTAGTAGTTAAA
GAATTTTAAGATTTACTTAAGGCACTAGGGCTCTCAGAAGCAAATATGGAGGAAGGTTAG
ATGAGGTGCGATGTTAATATATCAGTAAGTAACGAAGAGAAAGGCCTCTAAGGTAACAGA
GTTGAAATTAAGAATGTTCTTGGTGCAAAATTTGTAGAGAAAGCAATTGAGTACGAAGTT
ATGAGGCATGTTGATTTACTTTTAAAGGGAGAGCCAATCATGAAGGAAACTCGTAGGTAC
GACTCACTTGAAGACAAAACTATAAGTTTGAGATCTAAAGAGCAAGATCCTGATTATAGA
TTCTTTTAAGATCCAGATTTACCTTGCATCTCAGTAACACCAGACAGAATCAGGAGAATA
GAATAGACATTAATGCCAACCCCATTTGAGAGAAGAAACAGTTTTATAGAGAAGTATAAT
CTATAAATTTGGGAAGTCTTGACTATTTTTAGTTAAGATGAATTAGTTCCAATATTTGAA
AAGCTTGCAGATGACAAGACAAAAAGTAGAGATCCTAAGAACTTATTCAACTGGTTCTTC
ACTCACATCTACGGTAACATACAGAAGAAAGGCTTAGATTTGCTGCCTATAATTAATAAG
AATTTTAAAAACGGAGACTATGTAGCTGAATTGATAGATCTCGTATCTAATGAAAAGCTT
TCCATTAACAATGCTAAAATGATAGCCTATAAAATAATTGATGGAGATCTTAGGGAACCC
CTATAAATAGCTTAATTTGAAAACTTACTAAGCACTGGGTCGATTGATTATGAAGCTGCC
ATTGACAAAGTATTAAAAGAGAAGGCTGATGTCGTTGAAAAAATCCTAAAAACTAAGAAA
GAAGGATAGATCTAATTTTTAGTTGGGCAAACTTTAAAGTTACTTAGGGGTAGTGGTGAT
GCTTAGAAAATACAAAGTATAATTAGAGAAAAGATAGGGCTTAAATGA


>Contig19332.0.g96(protein)
MEGLHLHQQKKEQLNETFKQFKVKIFSSLTQIIASLCSQLAQANTQTNYVDLALPGMLPV
LNEECLDLAIKASLAFKGHINPKIKFDRKHYFYSDMPQGYQITQKNYPIMERGKLYFYDR
NGKPKFINIQRIQMEQDSAKSFHDLQTHTLIDYNRAGMPLLEIVTEPEIDHPEDGKLVVK
EFQDLLKALGLSEANMEEGQMRCDVNISVSNEEKGLQGNRVEIKNVLGAKFVEKAIEYEV
MRHVDLLLKGEPIMKETRRYDSLEDKTISLRSKEQDPDYRFFQDPDLPCISVTPDRIRRI
EQTLMPTPFERRNSFIEKYNLQIWEVLTIFSQDELVPIFEKLADDKTKSRDPKNLFNWFF
THIYGNIQKKGLDLLPIINKNFKNGDYVAELIDLVSNEKLSINNAKMIAYKIIDGDLREP
LQIAQFENLLSTGSIDYEAAIDKVLKEKADVVEKILKTKKEGQIQFLVGQTLKLLRGSGD
AQKIQSIIREKIGLK