Identifiers and Description

Gene Model Identifier

Contig9091.0.g11

Standard Name

GAR1c

Aliases

Contig9091_0_g11

Description

Gar1/Naf1 RNA binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9091.0.g11(coding)
ATGGTAATCTTCATGGCGAAGTATGGGAAGTACATAGTAGACGAGGTAAATCACTATCTG
CATTAAGAAGAACTGCTTTCACAAATTAATCTCTCTGAATCTATTAAGAAGTAAAAACTA
GAAAATCATTTGTAAAATTCCAACAATAATAATGATCCTGATTCAAAGGCTTCATCTACT
ACGAAAAGCACTTCTCCCTTTCTAGAAAATTAAAATAAAAAGGAAAGAAAGAAACGCCAG
AAAAAGCTTAAGAATGAGCATTTGCTGCTTCCTGATGAAGAATCTGAAAACTTTTATAAT
GAGAAAGAATCACCGGTCAAATAACTCACTAATAATCCTAAAAGTCCCATTAAAATAGCC
AATTTAAGCGATAAAATTCATGAAGTTGATGATGAAGAGGATGAGTATGATTCAAGAGAT
GACAGCGATGAAGATTCTGATTAATCAGACTCAGATTAGTAAATACCACCAAATTTAGCA
AAGAAAAAGCGTTATTACTACGATGACGATGATACTTATGTGTATGGCTAGGTTTAAAAG
CAAAAACGAAGTAACGATGAGTCACAAGACGATGATGAGGATATGTTGGATGAAAATCAG
TATGAATTTTAGGAGGATGAACTGGCTATGTACCTAAATGACGATTTCAATGAATAAATG
CTAAATGATGAAGAAGTTGAGGAGAGTATAGTGTAATCCACTTAAATAGGGGGTGGAGAA
GAAAATACTTATATTATGCAAGACATCAACAATTTTGATGTTTAACAAGACACAATCAGT
CATGATTAGTAAGAATAAACCTAATTGTTAGATTAAGAGCAATAGTAGATGCTTTTAGAA
GGCGTAGTAGATGATGAGGATATAATACAGACTTAAATAGAGACATAACAATTAACTCAA
CTGCAGAAAAATATTATTACTGCTGAATAAGATTAGTAACAATTTGAACTAAATACCATT
TTCAAAGTAAATTAGGATTTCAATGAAAATAAGCTCAGTAAGTTCCAAAGTGACTAAATA
GATAATGATCCTGATGAATTGTGTTCTGAAGATACACTAGACGAAAATAGATAAGTTGAC
TGA


>Contig9091.0.g11(protein)
MVIFMAKYGKYIVDEVNHYLHQEELLSQINLSESIKKQKLENHLQNSNNNNDPDSKASST
TKSTSPFLENQNKKERKKRQKKLKNEHLLLPDEESENFYNEKESPVKQLTNNPKSPIKIA
NLSDKIHEVDDEEDEYDSRDDSDEDSDQSDSDQQIPPNLAKKKRYYYDDDDTYVYGQVQK
QKRSNDESQDDDEDMLDENQYEFQEDELAMYLNDDFNEQMLNDEEVEESIVQSTQIGGGE
ENTYIMQDINNFDVQQDTISHDQQEQTQLLDQEQQQMLLEGVVDDEDIIQTQIETQQLTQ
LQKNIITAEQDQQQFELNTIFKVNQDFNENKLSKFQSDQIDNDPDELCSEDTLDENRQVD