Identifiers and Description

Gene Model Identifier

Contig148.0.g12

Standard Name

GAR1b

Aliases

Contig148_0_g12

Description

Gar1/Naf1 RNA binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig148.0.g12(coding)
ATGGTAATCTTCATGGCCAAGTATGGGAAGTACATAGTAGACGAGGTAAATCACTATCTG
CATTAAGAAGAACTGCTTTCACAAATTAATCTGTCTGAATCCATTAAGAAATAAAAACTA
GAAAATCATTTGCAAAATTCCAACAATAATAATGATCCTGATTCAAAGGCGTCATCTATT
ACGAAAAGCACTTCTCCCTTTCTGGAAAATTAAAATAAAAAGGAAAGAAAGAAACTCTAG
AAAAAGCTTAAGAATGATCATTTGCTACTGCCTGATGAGGAAAGTGAGAACTTATATAAT
GAGAAAGAATCACCAGTCAAATAACTCACTAACAATCCTAAAAGTCCCATTAAAATAGCC
AATTTAAGTGATAAAATTCATGAAGTTGATGATGAAGAGGAGGATGAGTATGATTCAAGA
GATGACGGCGATGAAGATTCTGAATAATCAGACTCAGATTAGTAATTACCAACGAATTTA
GCAAAGAAAAAGCGTTATTACTACGATGACGACGACACTTATGTGTATGGTTAGGTTTAA
AAGCAAAAACGAAGTAACGATCAGTCACAAGACGATGATGAGGATATGTTGGATGAAAAT
CAGTATGAATTTCAGGAGGATGAGCTGGCTATGTACCTAAATGACGATTTCAATGAATAA
ATGCTAAATGATGAAGAAGAAGTTGAGGAGAGTATAGTGCAATCCACTTAAATAGGGGTG
GAGAAGATAATACTTATATCATTCAAGACATCAATAATTGTGATGTTTAACAAGACATAA
TCAATAGTAATGATGATAAAACCTAATTGTTAGATCAAGACCAAGAATAGATGCTTCTAG
AGGGTATAGTAGAAGATGAGGATATAATACAGACTTAAATAGAGACATAACAATAAACTC
AACTGCAGAACAATATTATTAATGCTGAATAAGATTAGTAACACTTTGAACCACATACCA
TTTTTCAAAGTAAATTAGGATTTCAATGAAAATAAGCTCAGCAAATTACAAAATGACTAA
ATAGATAATGATCCTGATGAATTGTGTTCTGAAGATACACTAGACGAAAATAGATAAGTT
GACTGA


>Contig148.0.g12(protein)
MVIFMAKYGKYIVDEVNHYLHQEELLSQINLSESIKKQKLENHLQNSNNNNDPDSKASSI
TKSTSPFLENQNKKERKKLQKKLKNDHLLLPDEESENLYNEKESPVKQLTNNPKSPIKIA
NLSDKIHEVDDEEEDEYDSRDDGDEDSEQSDSDQQLPTNLAKKKRYYYDDDDTYVYGQVQ
KQKRSNDQSQDDDEDMLDENQYEFQEDELAMYLNDDFNEQMLNDEEEVEESIVQSTQIGV
EKIILISFKTSIIVMFNKTQSIVMMIKPNCQIKTKNRCFQRVQQKMRIQYRLKQRHNNKL
NCRTILLMLNKISNTLNHIPFFKVNQDFNENKLSKLQNDQIDNDPDELCSEDTLDENRQV
D