Identifiers and Description

Gene Model Identifier

Contig22355.0.g62

Standard Name

GAR1

Aliases

Contig22355_0_g62

Description

Gar1/Naf1 RNA binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR089C3.0007793728221555e-22GAR1 SGDID:S000001131, Chr VII
I from 283298-282681, Gen...
T. thermophilaTTHERM_009295909.99946582325553e-18Gar1 protein RNA binding regio
n containing pr...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22355.0.g62(coding)
ATGAGAGGCGGATTTAGAGGAGGTGCTCCCAGAGGTGGCAGAGGCGGTTTCAGCGGTGGC
CGTGGAGGCAGCAGAGGTGGCTTCGGTGGAGGCAGAGGTGGCTTCGGAGGTGGAAGAGGT
TTCGACCAAGGTCCCCCAGACTATGTTGAGCAAGTTGCTGAATTCTCTCACGCTTGTGAA
GGCATGCTTATTTGCTTTAACACAACCGACAACGTACCACTTTTGATGAGAAATATCTAT
TTGCTTAACAAGACCAAAGTCGGTAAAGTCGATGATGTTTTCGGAGGTATCTCAAAGTCA
GGTATTGCCATTAAGCCCGATGAAGGTGTCAAGGCCGAAAGCTTCAAAGCTGGAGATAAG
TTATACGCTGATCCATAACAATGCAGACAAACTTCTTTCTTCTTGCCAAGACCCGCTTAC
CCCAAGGCCTCTAAACCAAGAGACCAACAAGGTAAAAATGCTGGTGCTCAAGGCTTCAAG
CCAAGAGGCGGCTTCGGTGGTGACAGAGGAAGAGGTGGCTTCCGCGGTGGCGACAGAGGC
GGTTTCCGTGGAGGAGACAGAGGTGGTTTCCGTGGTGGAGACAGAGGTGGATTCCGTGGA
GGAAGCAGAGGTGGATTCGGCGATAGAGGCGGATTCAGAGGAGGAAGAGGTGGCTATTGA


>Contig22355.0.g62(protein)
MRGGFRGGAPRGGRGGFSGGRGGSRGGFGGGRGGFGGGRGFDQGPPDYVEQVAEFSHACE
GMLICFNTTDNVPLLMRNIYLLNKTKVGKVDDVFGGISKSGIAIKPDEGVKAESFKAGDK
LYADPQQCRQTSFFLPRPAYPKASKPRDQQGKNAGAQGFKPRGGFGGDRGRGGFRGGDRG
GFRGGDRGGFRGGDRGGFRGGSRGGFGDRGGFRGGRGGY