Identifiers and Description

Gene Model Identifier

Contig18741.0.g63

Standard Name

GAPDH1b

Aliases

Contig18741_0_g63

Description

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (IEA) | GO:0016620

Biological Process

Domains

  • ( pfam02800 ) Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  • ( pfam00044 ) Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005511601.999126889527329e-167glyceraldehyde-3-phosphate deh
ydrogenase, typ...
SGDYGR192C3.9988573992424687e-147TDH3 SGDID:S000003424, Chr VII
from 883810-882812, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18741.0.g63(coding)
ATGTCAGTAGTCAGACTCGGTATTAACGGATTTGGTAGAATTGGTAGACTCACCTTCAGA
GCTGCCGCCTCAAACAAGAACGCTCAGGTAATGGCCATTAACGATCCATTCATGGATATC
GACTATCTCATCTATCTCCTCAAGTACGACTCAGTTCATGGAAGATTCTAAGGCGAGATC
AAGAAGGTCGACGGTGGAATTGAGGTCAATGGTCACAAAGTTAGAGTTTATCAAGAGAAA
GATGCTTCCCAAATTAAATGGGGTGAAGCCGGAGCTGATTACGTCGGTGAGTGCAGTGGT
GCCTTCACTTCCCTCGAAAAGGCCTCTCTCCATCTTAAGGGTGGTGCCAAGAAGGCTATC
ATCTCAGCTCCTCCCAAGGATGCTGTCCCTATCTATGTCATGGGAGTCAACCATAACGAA
TACAAGCCAGATCAAAATGTTGTCTCAAATGCATCATGTACCACTAACTGCCTCGCTCCA
GTTGCTAAGGTCATCAACGATAACTGGGGAATCGATGAAGGTCTCATGACAACTGTCCAC
GCTGTTACCATTAATCAACTCACCGTTGACGGCCCATCAAAGGGAGGTAAAGACTGGAGA
GCTGGAAGAGCTGCTGGTGCCAACATTATTCCATCCACCACTGGAGCTGCCAAGGCTGTT
GGTAAAGTTATCAAGGAGCTCAATGGAAAATTGACAGGTATGGCTTTCAGAGTCCCAACC
ACTGATGTTTCAGTTGTTGATCTCACTGTTAAACTCCAAAAGGATGCTTCATATGCTGAA
ATTTGCCAAAAGATCAAGGAAGCCTCAGAAGGTTCCATGAAAGGATTCCTCGGTTACACC
GAAGATGAGGTCGTCTCCTCTGACTTCATTCACTCTCCACTTTCATCAATCTTTGACGCA
AAGGCTGGTATTGCTCTTAACTCAAAGTTCGTCAAGGTTGTCTCTTGGTACGACAACGAA
TGGGGATACTCCAACAGAATGGTAGACCTCGCTTAACACATGGCCAAGGTAGACGGCAAC
CTCAAGTGA


>Contig18741.0.g63(protein)
MSVVRLGINGFGRIGRLTFRAAASNKNAQVMAINDPFMDIDYLIYLLKYDSVHGRFQGEI
KKVDGGIEVNGHKVRVYQEKDASQIKWGEAGADYVGECSGAFTSLEKASLHLKGGAKKAI
ISAPPKDAVPIYVMGVNHNEYKPDQNVVSNASCTTNCLAPVAKVINDNWGIDEGLMTTVH
AVTINQLTVDGPSKGGKDWRAGRAAGANIIPSTTGAAKAVGKVIKELNGKLTGMAFRVPT
TDVSVVDLTVKLQKDASYAEICQKIKEASEGSMKGFLGYTEDEVVSSDFIHSPLSSIFDA
KAGIALNSKFVKVVSWYDNEWGYSNRMVDLAQHMAKVDGNLK