Identifiers and Description

Gene Model Identifier

Contig3016.0.g4

Standard Name

GAPDH1a

Aliases

Contig3016_0_g4

Description

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (IEA) | GO:0016620

Biological Process

Domains

  • ( pfam02800 ) Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  • ( pfam00044 ) Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005511608.001386819130079e-160glyceraldehyde-3-phosphate deh
ydrogenase, typ...
SGDYJR009C3.0009023271667765e-140TDH2 SGDID:S000003769, Chr X f
rom 454681-453683, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3016.0.g4(coding)
ATGTCACAAGTTAGATTAGGTATTAACGGATTCGGTAGAATTGGTCGTCTCACTCTCAGA
GCTGCCTTCCAAGACAAGCAGAATGTTGCCAAGGTCGTTGCTGTCAACGATGGCAAGCCA
GATTTGGACTATTAACTCTATTTGCTCAAGTACGACTCTGTTCATGGGAATTTCCCAGGT
GAGCTTAAGACCTATGATAAAGGTCTGATAATTAATGGTCAGAAAGTCAGATTCTTCAGT
GAGAGAGATGCTTCCAAGCTTCAATGGGGTGAGGAAGGAGCCGACTATATCTGCGAAAGC
ACTGGAGCTTACACCAAGAAAGAAGGAGCATCCCTTCATTTAAAGGGTGGAGCCAAGAAA
GTTATCATCTCCGCTCCTCCTAAGGACGATGTACCCATCTATGTTATGGGAGTGAATCAT
CTTAAATATACAACTGATCAAGACGTTGTGTCAAATGCATCTTGCACTACTAATGGTTTA
GCACCAGTCGTAAAAGTTATCCATGATAACTGGGGTATTGAAGAAGGACTCATGACAACC
GTTCATGCCATGACTATTAATCAACTCACTGTTGATGGCCCAGCAAAGGGTGGTAAAGAT
TGGAGAGCTGGTAGAGCTGCCAGTGCTAACATCATTCCATCAACAACTGGTGCAGCAAAG
GCAGTCGGTAAAGTTATCAAGGAACTCAATGGAAAAATCACTGGTATGGCTTTCAGAGTA
CCTACTACAAACGTATCAGTCATTGATCTTACAGTCAGACTTCAGAAGGACGCTACTTAT
GATGAGATTTGCAAAAAGATGAAGGAGGAGTCAGAAGGAACTCTTAAGGGCATCCTTGGT
TACACTGAAGACGCTGTTGTCTCCCAAGATTTCGTTAGTAATCCACTATCAACTATTTTC
GACGCCAAAGCAGGAGTCTCTCTCAACCCTAGATTTGTAAAGGTAGTCTCATGGTACGAT
AATGAATGGGGATATTCACACAGAATGATAGACTTAGCTCACCATATGGCCAAAGTAGAT
GGAAACCTCAAGTGA


>Contig3016.0.g4(protein)
MSQVRLGINGFGRIGRLTLRAAFQDKQNVAKVVAVNDGKPDLDYQLYLLKYDSVHGNFPG
ELKTYDKGLIINGQKVRFFSERDASKLQWGEEGADYICESTGAYTKKEGASLHLKGGAKK
VIISAPPKDDVPIYVMGVNHLKYTTDQDVVSNASCTTNGLAPVVKVIHDNWGIEEGLMTT
VHAMTINQLTVDGPAKGGKDWRAGRAASANIIPSTTGAAKAVGKVIKELNGKITGMAFRV
PTTNVSVIDLTVRLQKDATYDEICKKMKEESEGTLKGILGYTEDAVVSQDFVSNPLSTIF
DAKAGVSLNPRFVKVVSWYDNEWGYSHRMIDLAHHMAKVDGNLK