Identifiers and Description

Gene Model Identifier

Contig7422.0.g19

Standard Name

FUBP1d

Aliases

Contig7422_0_g19

Description

KH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000517207.998167219297731e-26KH domain containing protein
SGDYLR116W0.00000000000001000191320216021MSL5 SGDID:S000004106, Chr XII
from 380822-382252, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7422.0.g19(coding)
ATGGAAGAATCTTAAGAAAGAAAAAGCGTTGAAAGAGAGAGATACAGATCGAAAGAGAGA
AAAAGTAGATTCGATGATCAGGAAAATGCAAAAATTTTAAATGCTTTAAGCTCTGATTTC
CCCAGACTTAGCTAAATATGTCACGATGCAAAAAATGACGTTTCATAGAAAAGATTAGAG
CAAAGTAGAAAGCATAATAAGTCCAGAGATTACCAAGCAGATATTTAGTCTTAGATCAAA
AGCTAAATGTATAAGATAAAAAGAAACATCATGAGTTCAATTGACAAGGATAACAAATTT
AAGAGAAGAGATAGCAGAGGAAAGAAAAGTTTCAAAGGTGTTTCATAAAAAAATAGGGCA
AGATCTTACTATCTTAGTCACAGAGAAAGACAATAATCAAGTTATTCGTCTTCAAGAAGC
CGGAGTAGAAGCAGGTCATATGAAAAAATCAGACATGAAAGATTTGATTCTCGAAAATAT
CAAAAGTCTTTCCATGTAAAAAGCTTTAATTTCAATAAAGATCGAAAATCTAGAGACATT
AGCAATTACTTCGAAGAGAAGCTCAAAGATCGATTACGAAACTCATCGCCATTTTGGCCA
AACAATAAGTTTCATAAAAGAAATACATTTTAAGAATACAATAGAGGAGGTAGAAGTAGA
TCAAGGAATAAAACATTTGGAAATTAAAGAATCCGTACTCCAGAGCAAGCCTAAGCTCAC
ACATATAATTAGAGAATTCAACAAGAAGAATAAAAAATGAAAAGTGACAAGCAAATAAAT
GAAGAGCCAAAGCCATTATAAATTGAGATTAGTGACAAAAGGTTTCAAATACAGCCAAGT
TTAGAAAACATTCTCACAAAGAAACCATATTTTGAAGCTCCAAGACTTCAAGTAACGCCT
ATAGAGAAAACTGGCTCTGTTAGCAAATTTCAAATACCAGGGCTAATTCAAACCTACATA
ACAACATAGCCAGAGGGATAGCGATTTAAAGCAAAAATTTACTTACCAAGGAACACTGGA
ATAAATTACGTTGGCTTGCTCATAGGTCCTAAAGGAATTTATCAAAAGAAACTCGAGGAG
CAAACTGGATGCAAAATCTTGATTAGAGGGAGAGGTTCACACAAAGAAGGTCATCCAATG
CAAAATAATGATTAGGAAGATCAGCATGTTCTGGTTATAGGTGAAACTGAAGACAGAACT
TAAAATGCTGCTCAAGTCATTCAGAGAGTCATATCTGCAGATGAAGAAACTCGCAATGCC
ATAAGACTGGAACAATGCTTTGCAGCAAATGAAATGCAGAAGGATCTTTATGTTCACAAT
ATTGATGATTACTTGTTGACGCCTTATGGACCACCCACCCCTTAAGCTTTAATTATACCA
GTTCCAAACGAATGTGTTGGACTTATAATAGGTAAAGGAGGCGAAACTATTCGATATTTA
TAAATGAAGTCAGGTTCCAAAATTTAAGTGGCAAAGAAGGAGATTCCCAATTCTACTATG
AGGTATGTATTCATTGAGGGTAACTAGGAGAAATTCGATGGCGCTAAGAAATTGATTGAA
AACATAGTTGATGAGCATAGAATAATGCAAGAGTAATTTTCTTCATAAGGAGAGATCAAT
CGATTCCCTGGACCTTATTCTTTCTTTCCTATTCCGGATACTCTAATTGATATCATAATT
GGTCAACATGGATAGACTATAAAACTGTTGCATCAAAAGACAGGCTGCTATATTTTCATT
CCTGACGAAGTTACTGAAAAGAATGAGAGAATCTTGTAACTCTCTGGCTCTATAGATTCA
GTTGACAAATGCAAAATCGAACTATCACAAATATTAGAGAATGTAAAAAACTATGCAGAC
ACTACAGGTTAAACATTGAATTTTCAAATGCAAAAATCAAGTTTCTTGTAGCAAAATGAT
ATTCCAAAGCCAGACTTACTAGAATAAGCTATAAAACAAAAACAAATTCTGTTTCCAAAG
TAAAACAATTTTAATGAATCAGAGGTAAAAGATGAACCAAATATTAATGAAGCAATAAAT
CAGAAAGTTAGTCAACAATTCTTATTAGTAAATTAAAAAGACTTCCTTTTCGATCATATT
GCTGCAGCTTACTATGAAAGATTCACTAAATTCGTGTAAGGTTAACCACTTAACTTTGAT
GAGTTACCTTGGCCTGCTCTTCATGAGAGTAGAATGGAAAAGTTCCCCTAAAAATACAAG
ACATATTTCGAGGAGTATACTGAAAAATACGGTTAGGTAGCTAATAAAGCCAAATAAGTT
ATTGAGACTGATTTTAATGCTTCATCTGAAACAACGAATGCTTCTATAAACTCAACAAAC
ACTATAATCCAGAGCTAAAACTAGAAAAAGGTCTATTAATCACAAGTGAGGGAGCCATAG
ATTTATAATAATCCTAATTCCAATATCTACCCTGAAACTATGTAAAATCCTCAATGTTAA
ACAATGATGAGTCAAAGCTAACAAGTTTCTTTCACTTAATCGTAAAACTGCTACTTATCA
CAACCGATGCTAAATTATTCAAATTAATTCAGTTTGCCTAATTGGGCTTCAATGTAATAA
TAGTAAATTTAGCAGCCATATTCATAACACTACCCCATTTACAATAATTAACCTCAAAGT
TAAATTTACCTATCTTAGGATCACAGCACATAATACTATCAGATGCCTCCAAACAATGGG
TAGTAAAAGTAATCAGCAGTCAGTTTATTCTATCAATGTTTTGGCCCTGATGGTGCTCTC
ACTAATAAACTATACCAACAAAATAATAGTTATTTAACAAACCAATTCCATTTAGAGTCA
TAGAATGATGACTCAGATTTAATAATGCAAGATCAATAGTAGGAATAATTTGAGCAAGCA
AGTGAAGGAGATTTCGAAGGACTCATTATATGCAATGAGGACGAAGATGAACTTATTACA
CATGATAAAATAGAATTAAATATCGGAACTCAATGA


>Contig7422.0.g19(protein)
MEESQERKSVERERYRSKERKSRFDDQENAKILNALSSDFPRLSQICHDAKNDVSQKRLE
QSRKHNKSRDYQADIQSQIKSQMYKIKRNIMSSIDKDNKFKRRDSRGKKSFKGVSQKNRA
RSYYLSHRERQQSSYSSSRSRSRSRSYEKIRHERFDSRKYQKSFHVKSFNFNKDRKSRDI
SNYFEEKLKDRLRNSSPFWPNNKFHKRNTFQEYNRGGRSRSRNKTFGNQRIRTPEQAQAH
TYNQRIQQEEQKMKSDKQINEEPKPLQIEISDKRFQIQPSLENILTKKPYFEAPRLQVTP
IEKTGSVSKFQIPGLIQTYITTQPEGQRFKAKIYLPRNTGINYVGLLIGPKGIYQKKLEE
QTGCKILIRGRGSHKEGHPMQNNDQEDQHVLVIGETEDRTQNAAQVIQRVISADEETRNA
IRLEQCFAANEMQKDLYVHNIDDYLLTPYGPPTPQALIIPVPNECVGLIIGKGGETIRYL
QMKSGSKIQVAKKEIPNSTMRYVFIEGNQEKFDGAKKLIENIVDEHRIMQEQFSSQGEIN
RFPGPYSFFPIPDTLIDIIIGQHGQTIKLLHQKTGCYIFIPDEVTEKNERILQLSGSIDS
VDKCKIELSQILENVKNYADTTGQTLNFQMQKSSFLQQNDIPKPDLLEQAIKQKQILFPK
QNNFNESEVKDEPNINEAINQKVSQQFLLVNQKDFLFDHIAAAYYERFTKFVQGQPLNFD
ELPWPALHESRMEKFPQKYKTYFEEYTEKYGQVANKAKQVIETDFNASSETTNASINSTN
TIIQSQNQKKVYQSQVREPQIYNNPNSNIYPETMQNPQCQTMMSQSQQVSFTQSQNCYLS
QPMLNYSNQFSLPNWASMQQQQIQQPYSQHYPIYNNQPQSQIYLSQDHSTQYYQMPPNNG
QQKQSAVSLFYQCFGPDGALTNKLYQQNNSYLTNQFHLESQNDDSDLIMQDQQQEQFEQA
SEGDFEGLIICNEDEDELITHDKIELNIGTQ