Identifiers and Description

Gene Model Identifier

Contig17861.0.g105

Standard Name

FUBP1b

Aliases

Contig17861_0_g105

Description

KH domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004200001.9996410647472548e-29KH domain containing protein
SGDYBR233W0.000006997203421143941PBP2 SGDID:S000000437, Chr II
from 683428-684669, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17861.0.g105(coding)
ATGAAAGTTCAAGACTAATTTAGTGGTGATAAAAATAGCTAAGATCCCTTCACTCACCCT
TCAAGACAGGCAAATCAATCTACATCAGACTCTAAATATGATAAATTTCAGAAGGCTGTG
GTGCTGAAGATAGGCGAAGAAGCAAATATTCACCAAGGTAAAAGTCTAGGTCCAGGTCCT
CTTCTTATAGGAAAAAGCATTCAAGAACCAAAAATTCTAAGTCTAAAAGCAATTCTCGAT
CAGATTCATAAAGCAAACAAAGAAAGAGAGAAGCATCTAGATCAAATTCCAGACCCAAAT
ATACCACTGACCCCAGATCTTCAAGAACTTGCCAATAAACTATATGCAGCTAATCCAGCA
CTTACACTTAACACCACTCCATACTACTATCATTGGTCTCCAGGTCTCCATCCTAATATA
ACTAAGCTGTTGAATGATCCTTCGAAATTCAAGAAAAAGGTTTACATTCCATAGAGTCAG
CATATTAATTATGTGGGATTGCTTATCGGTCCAAAAGGCACTTATCAGAAAAAACTGGAA
GATGATACTGGATTTGGAGATTCAGAAAAATAGGTGAACGATGCTGAAACGACAATCTTG
AATGTTTTATATGCAAATGATGAAGAGAGAAACAAAATTAGAGCAGAGCAGTTAAAAGTA
GCAGAAGATCTTTAAATTTAAAGCTTTCCCTTCATAACTGACGACTCAATGATGACTCCT
TATGGCCCTCCTAGTCCGGCAGCTTTCATCATTCCAATACCAAATGACTGTGTGGGTTTA
ATAATTGGGAAGGGAGGTGAGACAATCAGAAATCTCTAACTACAAAGTGGTGCTAAGATT
CAAGTAGCAAAAAAGGAGTGTCAAGGAAACTAAATCAGAAATGTTTTTGTTGAGGGTCCA
CAAGAACGATACGATCTCGCGAAGAAACTCATTGACGAAATTGTGAATGAAGCAAGAAAA
CTCAATAAGACATCAAGTTTAACCACAAGTGGAAATAACATAGCATTCACAGCTGAGGTA
AATCCTTTCCCTGGACCTCATATCCCTTTCTCAATACCAAACTCACTCACTGGATTGATA
ATTGGTAAAAATGGAGACACTATTAAACAGCTTCATAATAAATGCGGTGCCTATATTTTT
ATTCCAAAATAACACGACCATCAAACAAATGAAAGGATTTTAGAGCTTTCTGGGAGTGAG
GAACAAATCGAAAGAGCTAAAAAGGAAATACAGAGACTGCTGGGAAATGCTGTTTTTGTT
AAACATTAAGATAACTAATCACTAAATAATGCAAATAATTCTAATCATGAGCAGAAGTAT
GAGATCCACCAACCGCCAGTCACTCATTCCTATAATAATCATGATATTAACTACGAATAT
TAAGGAATTATCAATTAAGAAATTGACTATTAAAACTCAGAGGAAAGCATGCTGAAATAT
ATGCAAAGTTTGTATAAAAATAAGGATGAAATACTTAAAAGAACTTGA


>Contig17861.0.g105(protein)
MKVQDQFSGDKNSQDPFTHPSRQANQSTSDSKYDKFQKAVVLKIGEEANIHQGKSLGPGP
LLIGKSIQEPKILSLKAILDQIHKANKEREKHLDQIPDPNIPLTPDLQELANKLYAANPA
LTLNTTPYYYHWSPGLHPNITKLLNDPSKFKKKVYIPQSQHINYVGLLIGPKGTYQKKLE
DDTGFGDSEKQVNDAETTILNVLYANDEERNKIRAEQLKVAEDLQIQSFPFITDDSMMTP
YGPPSPAAFIIPIPNDCVGLIIGKGGETIRNLQLQSGAKIQVAKKECQGNQIRNVFVEGP
QERYDLAKKLIDEIVNEARKLNKTSSLTTSGNNIAFTAEVNPFPGPHIPFSIPNSLTGLI
IGKNGDTIKQLHNKCGAYIFIPKQHDHQTNERILELSGSEEQIERAKKEIQRLLGNAVFV
KHQDNQSLNNANNSNHEQKYEIHQPPVTHSYNNHDINYEYQGIINQEIDYQNSEESMLKY
MQSLYKNKDEILKRT